KEGG   Homo sapiens (human): 10767
Entry
10767             CDS       T01001                                 

Gene name
HBS1L, EF-1a, ERFS, HBS1, HSPC276, eRF3c
Definition
(RefSeq) HBS1 like translational GTPase
  KO
K14416  elongation factor 1 alpha-like protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    10767 (HBS1L)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    10767 (HBS1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    10767 (HBS1L)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     10767 (HBS1L)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 HBS1_N GTP_EFTU_D2 MMR_HSR1 AAA_22 GTP_EFTU_D4 AAA_29
Other DBs
NCBI-GeneID: 10767
NCBI-ProteinID: NP_006611
OMIM: 612450
HGNC: 4834
Ensembl: ENSG00000112339
Vega: OTTHUMG00000015626
Pharos: Q9Y450(Tbio)
UniProt: Q9Y450 D9YZV0
LinkDB
Position
6q23.3
AA seq 684 aa
MARHRNVRGYNYDEDFEDDDLYGQSVEDDYCISPSTAAQFIYSRRDKPSVEPVEEYDYED
LKESSNSVSNHQLSGFDQARLYSCLDHMREVLGDAVPDEILIEAVLKNKFDVQKALSGVL
EQDRVQSLKDKNEATVSTGKIAKGKPVDSQTSRSESEIVPKVAKMTVSGKKQTMGFEVPG
VSSEENGHSFHTPQKGPPIEDAIASSDVLETASKSANPPHTIQASEEQSSTPAPVKKSGK
LRQQIDVKAELEKRQGGKQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESK
KAGKASFAYAWVLDETGEERERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAA
QADVAVLVVDASRGEFEAGFETGGQTREHGLLVRSLGVTQLAVAVNKMDQVNWQQERFQE
ITGKLGHFLKQAGFKESDVGFIPTSGLSGENLITRSQSSELTKWYKGLCLLEQIDSFKPP
QRSIDKPFRLCVSDVFKDQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLHDEP
VDWAAAGDHVSLTLVGMDIIKINVGCIFCGPKVPIKACTRFRARILIFNIEIPITKGFPV
LLHYQTVSEPAVIKRLISVLNKSTGEVTKKKPKFLTKGQNALVELQTQRPIALELYKDFK
ELGRFMLRYGGSTIAAGVVTEIKE
NT seq 2055 nt   +upstreamnt  +downstreamnt
atggcccggcatcggaatgttcgaggctataactacgatgaagattttgaagatgatgat
ctctacggccagtctgtagaggatgattattgtatttcgccgtcaacagctgctcagttt
atttattcacggcgtgacaaaccttccgttgagcctgtggaagaatatgattatgaagat
ctgaaagaatcttccaattctgtttcaaaccatcagctcagtggatttgatcaagctcgt
ctttattcatgccttgatcacatgagagaggtacttggagatgctgtgccagatgaaata
ttaattgaagcagttctgaagaacaagtttgatgtgcagaaggctttgtcaggggttctg
gaacaagatagagtgcagagtttgaaggacaagaatgaggcaacagtatctacaggaaag
atagcaaaaggaaaaccagtagattcccagacatcgcgaagtgaatctgaaattgtgcca
aaagttgctaaaatgactgtatctggaaagaagcaaactatgggatttgaagtgcctgga
gtatcttctgaagaaaatggtcatagtttccacacacctcaaaaaggaccgcccattgaa
gatgccattgcttcttccgatgttcttgagactgcttctaaatctgctaatccaccccac
acgattcaagcatcagaagagcagagttcaaccccagcaccggtgaaaaagtctggcaag
ctgaggcagcaaatagatgtgaaggcggaactggagaagcggcaaggagggaagcagcta
ctcaacttagtggtcattggtcatgttgatgctgggaaaagtactctgatgggccatatg
ctttatcttctgggtaatataaacaaaagaactatgcataagtatgaacaggagtctaaa
aaggctggcaaagcttcgtttgcatatgcatgggtcttggatgaaactggcgaagaaagg
gaaaggggagtaaccatggatgttggtatgacaaagtttgaaaccacaaccaaagttatt
acattaatggatgctccaggccataaggacttcattccaaatatgattacaggagcagcc
caggcggatgtagctgttttagttgtagatgccagcaggggagagtttgaagctggattt
gagactggaggacaaacacgagagcatggactcttggtccgttctctgggagtgacgcag
cttgcagttgcagttaataaaatggatcaggttaattggcaacaagaaaggtttcaagag
attactggaaaacttgggcactttcttaagcaagcaggttttaaggagagtgatgtaggt
tttattcctacaagtggtctcagtggtgaaaatctaatcacaagatctcagtcaagtgaa
ctcacaaaatggtataaaggactatgtttattagaacaaattgattcctttaagcctccc
cagcgatctattgacaaaccttttagattatgtgtgtccgatgttttcaaagatcaagga
tctggattttgcataactggtaaaatagaagctggttatatccaaactggtgaccgacta
ctggcaatgcctcctaatgaaacttgtaccgtgaaaggaatcactctgcatgatgaacct
gtcgactgggcggcagcaggcgatcatgttagtcttactttggttgggatggatatcatc
aaaatcaatgttggctgcatattttgtggccccaaagtacccattaaagcttgcactcgt
ttcagagcccgaatcctcatctttaatattgaaattcctatcactaaaggatttcctgtg
ctgttacactaccaaactgtcagtgaacccgccgttattaaacgattgattagtgtctta
aacaaaagcacgggtgaagtcacaaagaaaaagcctaagtttttgactaaaggccagaat
gcattggtagagctacagacacaaagaccaatagctcttgagctatataaagactttaaa
gagctggggaggttcatgctacgttacggtggttctacaatagctgctggtgttgtcact
gagataaaagaatga

DBGET integrated database retrieval system