KEGG   Homo sapiens (human): 107984264Help
Entry
107984264         CDS       T01001                                 

Definition
(RefSeq) transmembrane protein 108-like
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Gag_p10 Fanconi_C
Motif
Other DBs
NCBI-GeneID: 107984264
NCBI-ProteinID: XP_016872515
LinkDB All DBs
Position
10q24.32
AA seq 346 aa AA seqDB search
MENMVTLFRAVEEHCPLFPEKGTLDVELWDRVGAKFRELVPTGNYVPVTVWGDWALVCAV
LMTYQSHHPLQLPQFSESGNPPPLPQPSSPARPSLPDQPLPSPTPSPPEDIEDSISNSSD
FGLTSPPDDLISFHEQPVLVAPTAPTWTAQDCIYANSSLFKPLQPLPPEPSNGSGTKLQF
TCNSAGPPPSTTAPHPPVISVPQLVTLPSTQPASLYPSSHVDTPATLVAQDWAIITSMLL
PLLLLWCPFLTLSYWSNLLSLSFPYLHIIFLSLLCQLCLMCLLLKFPCNAYYAKTNKWIR
GVGLSVHAGTLQCSRGTSASIGAAQSYLFKRIQGCLYSVWSYFSIC
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatggtcaccctattcagggcagtggaagaacattgtcctttgtttcctgaa
aagggaacattagacgtggaactatgggatcgtgttggtgcaaaattccgggaactggtc
ccaacaggaaattatgttcccgtcactgtttggggtgactgggccttggtatgtgccgtc
ctaatgacataccaatcccatcaccccctgcagttaccacagttttctgaatctggaaac
cctccacctcttcctcaaccttcctctcccgcacggccttcgttacctgatcagcctctc
ccttcgcctactccttccccacctgaggatattgaagattcaatatctaactccagtgac
tttggcttaacgtcaccccctgatgatcttatttcttttcacgaacagccagtacttgta
gctcccacggccccgacttggacagcccaggactgtatctatgctaactcttccctcttc
aaacctttgcagcctttgcctccggagccatctaatggctccggaactaaactacaattt
acctgtaattctgcaggccctcccccatccaccacagcccctcaccctcctgtcatttcg
gttcctcaactggtcactttgccatccactcaacctgcttctctgtacccttcttcacat
gtggacacccctgccactctggttgcacaggattgggcaataatcaccagtatgcttctg
cctcttctgctcctctggtgcccctttctcacgctctcatactggtccaacctcctcagc
ctcagtttcccttatctacacataattttcctgtcacttctgtgccaactctgtctcatg
tgcctgttgttgaaatttccatgcaatgcttattacgccaaaacaaacaagtggattaga
ggcgtgggcttatccgttcatgctggaaccttgcaatgctcaaggggtacaagtgcatcg
ataggcgctgctcaatcttacctttttaaaagaattcaaggatgcttgtactcagtatgg
tcctacttctccatatgttaa

DBGET integrated database retrieval system