KEGG   Homo sapiens (human): 10800
Entry
10800             CDS       T01001                                 

Gene name
CYSLTR1, CYSLT1, CYSLT1R, CYSLTR, HMTMF81
Definition
(RefSeq) cysteinyl leukotriene receptor 1
  KO
K04322  cysteinyl leukotriene receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Ablukast (DG01244): D02739 D02741
Cinalukast: D02846
Ibudilast: D01385<JP>
Montelukast (DG01066): D00529<JP/US> D08229
Pobilukast edamine: D02848
Pranlukast (DG01065): D02732<JP> D08408
Ritolukast: D02849
Sulukast: D02850
Tipelukast: D06659
Tomelukast: D02851
Verlukast: D02384
Zafirlukast: D00411<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    10800 (CYSLTR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    10800 (CYSLTR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    10800 (CYSLTR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Cysteinyl leukotriene
    10800 (CYSLTR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srw 7TM_GPCR_Srx 7TM_GPCR_Srv DUF420 Shisa COX7C MscS_TM TMEM234
Other DBs
NCBI-GeneID: 10800
NCBI-ProteinID: NP_001269115
OMIM: 300201
HGNC: 17451
Ensembl: ENSG00000173198
Vega: OTTHUMG00000021889
Pharos: Q9Y271(Tclin)
UniProt: Q9Y271 Q38Q91 Q38Q88
LinkDB
Position
Xq21.1
AA seq 337 aa
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQV
YMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFF
RCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDN
QTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTA
AFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGG
NFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggatgaaacaggaaatctgacagtatcttctgccacatgccatgacactattgatgac
ttccgcaatcaagtgtattccaccttgtactctatgatctctgttgtaggcttctttggc
aatggctttgtgctctatgtcctcataaaaacctatcacaagaagtcagccttccaagta
tacatgattaatttagcagtagcagatctactttgtgtgtgcacactgcctctccgtgtg
gtctattatgttcacaaaggcatttggctctttggtgacttcttgtgccgcctcagcacc
tatgctttgtatgtcaacctctattgtagcatcttctttatgacagccatgagctttttc
cggtgcattgcaattgtttttccagtccagaacattaatttggttacacagaaaaaagcc
aggtttgtgtgtgtaggtatttggatttttgtgattttgaccagttctccatttctaatg
gccaaaccacaaaaagatgagaaaaataataccaagtgctttgagcccccacaagacaat
caaactaaaaatcatgttttggtcttgcattatgtgtcattgtttgttggctttatcatc
ccttttgttattataattgtctgttacacaatgatcattttgaccttactaaaaaaatca
atgaaaaaaaatctgtcaagtcataaaaaggctataggaatgatcatggtcgtgaccgct
gcctttttagtcagtttcatgccatatcatattcaacgtaccattcaccttcatttttta
cacaatgaaactaaaccctgtgattctgtccttagaatgcagaagtccgtggtcataacc
ttgtctctggctgcatccaattgttgctttgaccctctcctatatttcttttctgggggt
aactttaggaaaaggctgtctacattcagaaagcattctttgtccagcgtgacttatgta
cccagaaagaaggcctctttgccagaaaaaggagaagaaatatgtaaagtatag

KEGG   Homo sapiens (human): 57105
Entry
57105             CDS       T01001                                 

Gene name
CYSLTR2, CYSLT2, CYSLT2R, GPCR21, HG57, HPN321, KPG_011, PSEC0146, hGPCR21
Definition
(RefSeq) cysteinyl leukotriene receptor 2
  KO
K04323  cysteinyl leukotriene receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    57105 (CYSLTR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    57105 (CYSLTR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    57105 (CYSLTR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Cysteinyl leukotriene
    57105 (CYSLTR2)
SSDB
Motif
Pfam: 7tm_1 TAS2R 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 57105
NCBI-ProteinID: NP_001295394
OMIM: 605666
HGNC: 18274
Ensembl: ENSG00000152207
Vega: OTTHUMG00000016906
Pharos: Q9NS75(Tchem)
UniProt: Q9NS75 Q5KU17 A4ZKH2
LinkDB
Position
13q14.2
AA seq 346 aa
MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSI
YVFLQPYKKSTSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYV
NMYSSIYFLTVLSVVRFLAMVHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQ
NGSVTSCLELNLYKIAKLQTMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRV
SHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCKDRLHKALVITLALAAANACF
NPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagagaaaatttatgtccttgcaaccatccatctccgtatcagaaatggaaccaaat
ggcaccttcagcaataacaacagcaggaactgcacaattgaaaacttcaagagagaattt
ttcccaattgtatatctgataatatttttctggggagtcttgggaaatgggttgtccata
tatgttttcctgcagccttataagaagtccacatctgtgaacgttttcatgctaaatctg
gccatttcagatctcctgttcataagcacgcttcccttcagggctgactattatcttaga
ggctccaattggatatttggagacctggcctgcaggattatgtcttattccttgtatgtc
aacatgtacagcagtatttatttcctgaccgtgctgagtgttgtgcgtttcctggcaatg
gttcacccctttcggcttctgcatgtcaccagcatcaggagtgcctggatcctctgtggg
atcatatggatccttatcatggcttcctcaataatgctcctggacagtggctctgagcag
aacggcagtgtcacatcatgcttagagctgaatctctataaaattgctaagctgcagacc
atgaactatattgccttggtggtgggctgcctgctgccatttttcacactcagcatctgt
tatctgctgatcattcgggttctgttaaaagtggaggtcccagaatcggggctgcgggtt
tctcacaggaaggcactgaccaccatcatcatcaccttgatcatcttcttcttgtgtttc
ctgccctatcacacactgaggaccgtccacttgacgacatggaaagtgggtttatgcaaa
gacagactgcataaagctttggttatcacactggccttggcagcagccaatgcctgcttc
aatcctctgctctattactttgctggggagaattttaaggacagactaaagtctgcactc
agaaaaggccatccacagaaggcaaagacaaagtgtgttttccctgttagtgtgtggttg
agaaaggaaacaagagtataa

DBGET integrated database retrieval system