KEGG   Homo sapiens (human): 1081Help
Entry
1081              CDS       T01001                                 

Gene name
CGA, CG-ALPHA, FSHA, GPA1, GPHA1, GPHa, HCG, LHA, TSHA
Definition
(RefSeq) glycoprotein hormones, alpha polypeptide
  KO
K08522  glycoprotein hormones alpha chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04917  Prolactin signaling pathway
hsa04918  Thyroid hormone synthesis
hsa04923  Regulation of lipolysis in adipocytes
hsa04929  GnRH secretion
hsa05320  Autoimmune thyroid disease
Network
nt06323  KISS1-GnRH-LH-estrogen signaling
  Element
N00873  GnRH-GnRHR-PLCB-PKC signaling pathway
N00875  Mutation-inactivated GnRHR to GnRH-GnRHR-PLCB-PKC signaling pathway
N00885  LHCGR-GNAS-PKA signaling pathway
N00886  Mutation-activated LHCGR to LHCGR-GNAS-PKA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    1081 (CGA)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1081 (CGA)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    1081 (CGA)
   04929 GnRH secretion
    1081 (CGA)
   04912 GnRH signaling pathway
    1081 (CGA)
   04913 Ovarian steroidogenesis
    1081 (CGA)
   04917 Prolactin signaling pathway
    1081 (CGA)
   04918 Thyroid hormone synthesis
    1081 (CGA)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    1081 (CGA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_6
Motif
Other DBs
NCBI-GeneID: 1081
NCBI-ProteinID: NP_000726
OMIM: 118850
HGNC: 1885
Ensembl: ENSG00000135346
Vega: OTTHUMG00000015161
Pharos: P01215(Tbio)
CPD: C18184 C18185 C18182 C18183
UniProt: P01215 Q6I9S8
LinkDB All DBs
Structure
PDB: 

Position
6q14.3
AA seq 116 aa AA seqDB search
MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRA
YPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggattactacagaaaatatgcagctatctttctggtcacattgtcggtgtttctgcat
gttctccattccgctcctgatgtgcaggattgcccagaatgcacgctacaggaaaaccca
ttcttctcccagccgggtgccccaatacttcagtgcatgggctgctgcttctctagagca
tatcccactccactaaggtccaagaagacgatgttggtccaaaagaacgtcacctcagag
tccacttgctgtgtagctaaatcatataacagggtcacagtaatggggggtttcaaagtg
gagaaccacacggcgtgccactgcagtacttgttattatcacaaatcttaa

DBGET integrated database retrieval system