KEGG   Homo sapiens (human): 1081
Entry
1081              CDS       T01001                                 

Gene name
CGA, CG-ALPHA, FSHA, GPA1, GPHA1, GPHa, HCG, LHA, TSHA
Definition
(RefSeq) glycoprotein hormones, alpha polypeptide
  KO
K08522  glycoprotein hormones alpha chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04917  Prolactin signaling pathway
hsa04918  Thyroid hormone synthesis
hsa04923  Regulation of lipolysis in adipocytes
hsa04929  GnRH secretion
hsa05320  Autoimmune thyroid disease
Network
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
  Element
N00873  GnRH-GnRHR-PLCB-PKC signaling pathway
N00875  Mutation-inactivated GnRHR to GnRH-GnRHR-PLCB-PKC signaling pathway
N00885  LHCGR-GNAS-PKA signaling pathway
N00886  Mutation-activated LHCGR to LHCGR-GNAS-PKA signaling pathway
N00922  FSHR-GNAS-PKA signaling pathway
N00923  Mutation-inactivated FSHB to FSHR-GNAS-PKA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    1081 (CGA)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1081 (CGA)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    1081 (CGA)
   04929 GnRH secretion
    1081 (CGA)
   04912 GnRH signaling pathway
    1081 (CGA)
   04913 Ovarian steroidogenesis
    1081 (CGA)
   04917 Prolactin signaling pathway
    1081 (CGA)
   04918 Thyroid hormone synthesis
    1081 (CGA)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    1081 (CGA)
SSDB
Motif
Pfam: Hormone_6
Other DBs
NCBI-GeneID: 1081
NCBI-ProteinID: NP_000726
OMIM: 118850
HGNC: 1885
Ensembl: ENSG00000135346
Vega: OTTHUMG00000015161
Pharos: P01215(Tbio)
CPD: C18184 C18185 C18182 C18183
UniProt: P01215 Q6I9S8
LinkDB
Structure
PDB: 

Position
6q14.3
AA seq 116 aa
MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRA
YPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
NT seq 351 nt   +upstreamnt  +downstreamnt
atggattactacagaaaatatgcagctatctttctggtcacattgtcggtgtttctgcat
gttctccattccgctcctgatgtgcaggattgcccagaatgcacgctacaggaaaaccca
ttcttctcccagccgggtgccccaatacttcagtgcatgggctgctgcttctctagagca
tatcccactccactaaggtccaagaagacgatgttggtccaaaagaacgtcacctcagag
tccacttgctgtgtagctaaatcatataacagggtcacagtaatggggggtttcaaagtg
gagaaccacacggcgtgccactgcagtacttgttattatcacaaatcttaa

KEGG   Homo sapiens (human): 6696
Entry
6696              CDS       T01001                                 

Gene name
SPP1, BNSP, BSPI, ETA-1, OPN
Definition
(RefSeq) secreted phosphoprotein 1
  KO
K06250  secreted phosphoprotein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04371  Apelin signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04620  Toll-like receptor signaling pathway
hsa04929  GnRH secretion
hsa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    6696 (SPP1)
   04151 PI3K-Akt signaling pathway
    6696 (SPP1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    6696 (SPP1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    6696 (SPP1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6696 (SPP1)
  09152 Endocrine system
   04929 GnRH secretion
    6696 (SPP1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    6696 (SPP1)
SSDB
Motif
Pfam: Osteopontin
Other DBs
NCBI-GeneID: 6696
NCBI-ProteinID: NP_001035147
OMIM: 166490
HGNC: 11255
Ensembl: ENSG00000118785
Vega: OTTHUMG00000130599
Pharos: P10451(Tbio)
UniProt: P10451 A0A024RDE2
LinkDB
Position
4q22.1
AA seq 314 aa
MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNA
VSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQS
DESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQ
YPDATDEDITSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSH
KQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKF
RISHELDSASSEVN
NT seq 945 nt   +upstreamnt  +downstreamnt
atgagaattgcagtgatttgcttttgcctcctaggcatcacctgtgccataccagttaaa
caggctgattctggaagttctgaggaaaagcagctttacaacaaatacccagatgctgtg
gccacatggctaaaccctgacccatctcagaagcagaatctcctagccccacagaatgct
gtgtcctctgaagaaaccaatgactttaaacaagagacccttccaagtaagtccaacgaa
agccatgaccacatggatgatatggatgatgaagatgatgatgaccatgtggacagccag
gactccattgactcgaacgactctgatgatgtagatgacactgatgattctcaccagtct
gatgagtctcaccattctgatgaatctgatgaactggtcactgattttcccacggacctg
ccagcaaccgaagttttcactccagttgtccccacagtagacacatatgatggccgaggt
gatagtgtggtttatggactgaggtcaaaatctaagaagtttcgcagacctgacatccag
taccctgatgctacagacgaggacatcacctcacacatggaaagcgaggagttgaatggt
gcatacaaggccatccccgttgcccaggacctgaacgcgccttctgattgggacagccgt
gggaaggacagttatgaaacgagtcagctggatgaccagagtgctgaaacccacagccac
aagcagtccagattatataagcggaaagccaatgatgagagcaatgagcattccgatgtg
attgatagtcaggaactttccaaagtcagccgtgaattccacagccatgaatttcacagc
catgaagatatgctggttgtagaccccaaaagtaaggaagaagataaacacctgaaattt
cgtatttctcatgaattagatagtgcatcttctgaggtcaattaa

DBGET integrated database retrieval system