KEGG   Homo sapiens (human): 1081Help
Entry
1081              CDS       T01001                                 

Gene name
CGA, CG-ALPHA, FSHA, GPA1, GPHA1, GPHa, HCG, LHA, TSHA
Definition
(RefSeq) glycoprotein hormones, alpha polypeptide
  KO
K08522  glycoprotein hormones alpha chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04917  Prolactin signaling pathway
hsa04918  Thyroid hormone synthesis
hsa04923  Regulation of lipolysis in adipocytes
hsa04929  GnRH secretion
hsa05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    1081 (CGA)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1081 (CGA)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    1081 (CGA)
   04929 GnRH secretion
    1081 (CGA)
   04912 GnRH signaling pathway
    1081 (CGA)
   04913 Ovarian steroidogenesis
    1081 (CGA)
   04917 Prolactin signaling pathway
    1081 (CGA)
   04918 Thyroid hormone synthesis
    1081 (CGA)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    1081 (CGA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_6
Motif
Other DBs
NCBI-GeneID: 1081
NCBI-ProteinID: NP_000726
OMIM: 118850
HGNC: 1885
Ensembl: ENSG00000135346
Vega: OTTHUMG00000015161
Pharos: P01215(Tbio)
CPD: C18184 C18185 C18182 C18183
UniProt: P01215 Q6I9S8
LinkDB All DBs
Structure
PDB: 

Position
6q14.3
AA seq 116 aa AA seqDB search
MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRA
YPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggattactacagaaaatatgcagctatctttctggtcacattgtcggtgtttctgcat
gttctccattccgctcctgatgtgcaggattgcccagaatgcacgctacaggaaaaccca
ttcttctcccagccgggtgccccaatacttcagtgcatgggctgctgcttctctagagca
tatcccactccactaaggtccaagaagacgatgttggtccaaaagaacgtcacctcagag
tccacttgctgtgtagctaaatcatataacagggtcacagtaatggggggtttcaaagtg
gagaaccacacggcgtgccactgcagtacttgttattatcacaaatcttaa

KEGG   Homo sapiens (human): 7252Help
Entry
7252              CDS       T01001                                 

Gene name
TSHB, TSH-B, TSH-BETA
Definition
(RefSeq) thyroid stimulating hormone subunit beta
  KO
K05251  thyrotropin subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04918  Thyroid hormone synthesis
hsa04923  Regulation of lipolysis in adipocytes
hsa05320  Autoimmune thyroid disease
Network
nt06322  TSH-TG/TH-THR signaling
  Element
N00782  TSH-TG signaling pathway
N00783  Mutation-inactivated TSH to TSH-TG signaling pathway
N00784  Mutation-inactivated TSHR to TSH-TG signaling pathway
N00785  Mutation-inactivated PAX8 to TSH-TG signaling pathway
N00793  TSH-DUOX2-TG signaling pathway
N00794  Mutation-inactivated DUOX2 to TSH-DUOX2-TG signaling pathway
N00797  Mutation-activated TSHR to TSH-TG signaling pathway
Disease
H00250  Congenital nongoitrous hypothyroidism (CHNG)
H01699  Isolated TSH deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    7252 (TSHB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    7252 (TSHB)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    7252 (TSHB)
   04918 Thyroid hormone synthesis
    7252 (TSHB)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    7252 (TSHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cys_knot
Motif
Other DBs
NCBI-GeneID: 7252
NCBI-ProteinID: NP_000540
OMIM: 188540
HGNC: 12372
Ensembl: ENSG00000134200
Vega: OTTHUMG00000011881
Pharos: P01222(Tbio)
CPD: C18182
UniProt: P01222
LinkDB All DBs
Position
1p13.2
AA seq 138 aa AA seqDB search
MTALFLMSMLFGLTCGQAMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKL
FLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAI
KTNYCTKPQKSYLVGFSV
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgactgctctctttctgatgtccatgctttttggccttacatgtgggcaagcgatgtct
ttttgtattccaactgagtatacaatgcacatcgaaaggagagagtgtgcttattgccta
accatcaacaccaccatctgtgctggatattgtatgacacgggatatcaatggcaaactg
tttcttcccaaatatgctctgtcccaggatgtttgcacatatagagacttcatctacagg
actgtagaaataccaggatgcccactccatgttgctccctatttttcctatcctgttgct
ttaagctgtaagtgtggcaagtgcaatactgactatagtgactgcatacatgaagccatc
aagacaaactactgtaccaaacctcagaagtcttatctggtaggattttctgtctaa

DBGET integrated database retrieval system