KEGG   Homo sapiens (human): 10825Help
Entry
10825             CDS       T01001                                 

Gene name
NEU3, SIAL3
Definition
(RefSeq) neuraminidase 3
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00511  Other glycan degradation
hsa00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    10825 (NEU3)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    10825 (NEU3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     10825 (NEU3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR
Motif
Other DBs
NCBI-GeneID: 10825
NCBI-ProteinID: NP_006647
OMIM: 604617
HGNC: 7760
Ensembl: ENSG00000162139
Vega: OTTHUMG00000165518
Pharos: Q9UQ49(Tbio)
UniProt: Q9UQ49 A0A024R5N6
LinkDB All DBs
Position
11q13.4
AA seq 461 aa AA seqDB search
MRPADLPPRPMEESPASSSAPTETEEPGSSAEVMEEVTTCSFNSPLFRQEDDRGITYRIP
ALLYIPPTHTFLAFAEKRSTRRDEDALHLVLRRGLRIGQLVQWGPLKPLMEATLPGHRTM
NPCPVWEQKSGCVFLFFICVRGHVTERQQIVSGRNAARLCFIYSQDAGCSWSEVRDLTEE
VIGSELKHWATFAVGPGHGIQLQSGRLVIPAYTYYIPSWFFCFQLPCKTRPHSLMIYSDD
LGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTPNRCRAEALSTDHGEGFQRLA
LSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSES
WLLYSHPTSRKQRVDLGIYLNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFE
CGTKQECEQIAFRLFTHREILSHLQGDCTSPGRNPSQFKSN
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgagacctgcggacctgcccccgcgccccatggaagaatccccggcgtccagctctgcc
ccgacagagacggaggagccggggtccagtgcagaggtcatggaagaagtgacaacatgc
tccttcaacagccctctgttccggcaggaagatgacagagggattacctaccggatccca
gccctgctctacataccccccacccacaccttcctggcctttgcagagaagcgttctacg
aggagagatgaggatgctctccacctggtgctgaggcgagggttgaggattgggcagttg
gtacagtgggggcccctgaagccactgatggaagccacactaccggggcatcggaccatg
aacccctgtcctgtatgggagcagaagagtggttgtgtgttcctgttcttcatctgtgtg
cggggccatgtcacagagcgtcaacagattgtgtcaggcaggaatgctgcccgcctttgc
ttcatctacagtcaggatgctggatgttcatggagtgaggtgagggacttgactgaggag
gtcattggctcagagctgaagcactgggccacatttgctgtgggcccaggtcatggcatc
cagctgcagtcagggagactggtcatccctgcgtatacctactacatcccttcctggttc
ttttgcttccagctaccatgtaaaaccaggcctcattctctgatgatctacagtgatgac
ctaggggtcacatggcaccatggtagactcattaggcccatggttacagtagaatgtgaa
gtggcagaggtgactgggagggctggccaccctgtgctatattgcagtgcccggacacca
aacaggtgccgggcagaggcgctcagcactgaccatggtgaaggctttcagagactggcc
ctgagtcgacagctctgtgagcccccacatggttgccaagggagtgtggtaagtttccgg
cccctggagatcccacataggtgccaggactctagcagcaaagatgcacccaccattcag
cagagctctccaggcagttcactgaggctggaggaggaagctggaacaccgtcagaatca
tggctcttgtactcacacccaaccagtaggaaacagagggttgacctaggtatctatctc
aaccagacccccttggaggctgcctgctggtcccgcccctggatcttgcactgtgggccc
tgtggctactctgatctggctgctctggaggaggagggcttgtttgggtgtttgtttgaa
tgtgggaccaagcaagagtgtgagcagattgccttccgcctgtttacacaccgggagatc
ctgagtcacctgcagggggactgcaccagccctggtaggaacccaagccaattcaaaagc
aattaa

DBGET integrated database retrieval system