KEGG   Homo sapiens (human): 10825Help
Entry
10825             CDS       T01001                                 

Gene name
NEU3, SIAL3
Definition
(RefSeq) neuraminidase 3
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00511  Other glycan degradation
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    10825 (NEU3)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    10825 (NEU3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     10825 (NEU3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR
Motif
Other DBs
NCBI-GeneID: 10825
NCBI-ProteinID: NP_006647
OMIM: 604617
HGNC: 7760
Ensembl: ENSG00000162139
Vega: OTTHUMG00000165518
Pharos: Q9UQ49(Tbio)
UniProt: Q9UQ49 A0A024R5N6
LinkDB All DBs
Position
11q13.4
AA seq 461 aa AA seqDB search
MRPADLPPRPMEESPASSSAPTETEEPGSSAEVMEEVTTCSFNSPLFRQEDDRGITYRIP
ALLYIPPTHTFLAFAEKRSTRRDEDALHLVLRRGLRIGQLVQWGPLKPLMEATLPGHRTM
NPCPVWEQKSGCVFLFFICVRGHVTERQQIVSGRNAARLCFIYSQDAGCSWSEVRDLTEE
VIGSELKHWATFAVGPGHGIQLQSGRLVIPAYTYYIPSWFFCFQLPCKTRPHSLMIYSDD
LGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTPNRCRAEALSTDHGEGFQRLA
LSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSES
WLLYSHPTSRKQRVDLGIYLNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFE
CGTKQECEQIAFRLFTHREILSHLQGDCTSPGRNPSQFKSN
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgagacctgcggacctgcccccgcgccccatggaagaatccccggcgtccagctctgcc
ccgacagagacggaggagccggggtccagtgcagaggtcatggaagaagtgacaacatgc
tccttcaacagccctctgttccggcaggaagatgacagagggattacctaccggatccca
gccctgctctacataccccccacccacaccttcctggcctttgcagagaagcgttctacg
aggagagatgaggatgctctccacctggtgctgaggcgagggttgaggattgggcagttg
gtacagtgggggcccctgaagccactgatggaagccacactaccggggcatcggaccatg
aacccctgtcctgtatgggagcagaagagtggttgtgtgttcctgttcttcatctgtgtg
cggggccatgtcacagagcgtcaacagattgtgtcaggcaggaatgctgcccgcctttgc
ttcatctacagtcaggatgctggatgttcatggagtgaggtgagggacttgactgaggag
gtcattggctcagagctgaagcactgggccacatttgctgtgggcccaggtcatggcatc
cagctgcagtcagggagactggtcatccctgcgtatacctactacatcccttcctggttc
ttttgcttccagctaccatgtaaaaccaggcctcattctctgatgatctacagtgatgac
ctaggggtcacatggcaccatggtagactcattaggcccatggttacagtagaatgtgaa
gtggcagaggtgactgggagggctggccaccctgtgctatattgcagtgcccggacacca
aacaggtgccgggcagaggcgctcagcactgaccatggtgaaggctttcagagactggcc
ctgagtcgacagctctgtgagcccccacatggttgccaagggagtgtggtaagtttccgg
cccctggagatcccacataggtgccaggactctagcagcaaagatgcacccaccattcag
cagagctctccaggcagttcactgaggctggaggaggaagctggaacaccgtcagaatca
tggctcttgtactcacacccaaccagtaggaaacagagggttgacctaggtatctatctc
aaccagacccccttggaggctgcctgctggtcccgcccctggatcttgcactgtgggccc
tgtggctactctgatctggctgctctggaggaggagggcttgtttgggtgtttgtttgaa
tgtgggaccaagcaagagtgtgagcagattgccttccgcctgtttacacaccgggagatc
ctgagtcacctgcagggggactgcaccagccctggtaggaacccaagccaattcaaaagc
aattaa

KEGG   Homo sapiens (human): 129807Help
Entry
129807            CDS       T01001                                 

Gene name
NEU4
Definition
(RefSeq) neuraminidase 4
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00511  Other glycan degradation
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    129807 (NEU4)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    129807 (NEU4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     129807 (NEU4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR
Motif
Other DBs
NCBI-GeneID: 129807
NCBI-ProteinID: NP_001161072
OMIM: 608527
HGNC: 21328
Ensembl: ENSG00000204099
Vega: OTTHUMG00000133412
Pharos: Q8WWR8(Tchem)
UniProt: Q8WWR8 B3KR54
LinkDB All DBs
Position
2q37.3
AA seq 484 aa AA seqDB search
MGVPRTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPDDSHAHRLVLRRGT
LAGGSVRWGALHVLGTAALAEHRSMNPCPVHDAGTGTVFLFFIAVLGHTPEAVQIATGRN
AARLCCVASRDAGLSWGSARDLTEEAIGGAVQDWATFAVGPGHGVQLPSGRLLVPAYTYR
VDRRECFGKICRTSPHSFAFYSDDHGRTWRCGGLVPNLRSGECQLAAVDGGQAGSFLYCN
ARSPLGSRVQALSTDEGTSFLPAERVASLPETAWGCQGSIVGFPAPAPNRPRDDSWSVGP
GSPLQPPLLGPGVHEPPEEAAVDPRGGQVPGGPFSRLQPRGDGPRQPGPRPGVSGDVGSW
TLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWTEPWVIYEGPSGYS
DLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPASPKPPNLGDKPRGC
CWPS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgggggtccctcgtaccccttcacggacagtgctcttcgagcgggagaggacgggcctg
acctaccgcgtgccctcgctgctccccgtgccccccgggcccaccctgctggcctttgtg
gagcagcggctcagccctgacgactcccacgcccaccgcctggtgctgaggaggggcacg
ctggccgggggctccgtgcggtggggtgccctgcacgtgctggggacagcagccctggcg
gagcaccggtccatgaacccctgccctgtgcacgatgctggcacgggcaccgtcttcctc
ttcttcatcgcggtgctgggccacacgcctgaggccgtgcagatcgccacgggaaggaac
gccgcgcgcctctgctgtgtggccagccgtgacgccggcctctcgtggggcagcgcccgg
gacctcaccgaggaggccatcggtggtgccgtgcaggactgggccacattcgctgtgggt
cccggccacggtgtgcagctgccctcaggccgcctgctggtacccgcctacacctaccgc
gtggaccgccgagagtgttttggcaagatctgccggaccagccctcactccttcgccttc
tacagcgatgaccacggccgcacctggcgctgtggaggcctcgtgcccaacctgcgctca
ggcgagtgccagctggcagcggtggacggtgggcaggccggcagcttcctctactgcaat
gcccggagcccactgggcagccgtgtgcaggcgctcagcactgacgagggcacctccttc
ctgcccgcagagcgcgtggcttccctgcccgagactgcctggggctgccagggcagcatc
gtgggcttcccagcccccgcccccaacaggccacgggatgacagttggtcagtgggcccc
gggagtcccctccagcctccactcctcggtcctggagtccacgaacccccagaggaggct
gctgtagacccccgtggaggccaggtgcctggtgggcccttcagccgtctgcagcctcgg
ggggatggccccaggcagcctggccccaggcctggggtcagtggggatgtggggtcctgg
accctggcactccccatgccctttgctgccccgccccagagccccacgtggctgctgtac
tcccacccagtggggcgcagggctcggctacacatgggtatccgcctgagccagtccccg
ctggacccgcgcagctggacagagccctgggtgatctacgagggccccagcggctactcc
gacctggcgtccatcgggccggcccctgaggggggcctggtttttgcctgcctgtacgag
agcggggccaggacctcctatgatgagatttccttttgtacattctccctgcgtgaggtc
ctggagaacgtgcccgccagccccaaaccgcccaaccttggggacaagcctcgggggtgc
tgctggccctcctga

KEGG   Homo sapiens (human): 4758Help
Entry
4758              CDS       T01001                                 

Gene name
NEU1, NANH, NEU, SIAL1
Definition
(RefSeq) neuraminidase 1
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00511  Other glycan degradation
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04142  Lysosome
Disease
H00142  Sialidosis
H00422  Glycoproteinoses
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4758 (NEU1)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    4758 (NEU1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    4758 (NEU1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     4758 (NEU1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3
Motif
Other DBs
NCBI-GeneID: 4758
NCBI-ProteinID: NP_000425
OMIM: 608272
HGNC: 7758
Ensembl: ENSG00000204386
Vega: OTTHUMG00000031284
Pharos: Q99519(Tbio)
UniProt: Q99519 Q5JQI0
LinkDB All DBs
Position
6p21.33
AA seq 415 aa AA seqDB search
MTGERPSTALPDRRWGPRILGFWGGCRVWVFAAIFLLLSLAASWSKAENDFGLVQPLVTM
EQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGST
WSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVS
WSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASW
RYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACD
TLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKET
VQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgactggggagcgacccagcacggcgctcccggacagacgctgggggccgcggattctg
ggcttctggggaggctgtagggtttgggtgtttgccgcgatcttcctgctgctgtctctg
gcagcctcctggtccaaggctgagaacgacttcggtctggtgcagccgctggtgaccatg
gagcaactgctgtgggtgagcgggagacagatcggctcagtggacaccttccgcatcccg
ctcatcacagccactccgcggggcactcttctcgcctttgctgaggcgaggaaaatgtcc
tcatccgatgagggggccaagttcatcgccctgcggaggtccatggaccagggcagcaca
tggtctcctacagcgttcattgtcaatgatggggatgtccccgatgggctgaaccttggg
gcagtagtgagcgatgttgagacaggagtagtatttcttttctactccctttgtgctcac
aaggccggctgccaggtggcctctaccatgttggtatggagcaaggatgatggtgtttcc
tggagcacaccccggaatctctccctggatattggcactgaagtgtttgcccctggaccg
ggctctggtattcagaaacagcgggagccacggaagggccgcctcatcgtgtgtggccat
gggacgctggagcgggacggagtcttctgtctcctcagcgatgatcatggtgcctcctgg
cgctacggaagtggggtcagcggcatcccctacggtcagcccaagcaggaaaatgatttc
aatcctgatgaatgccagccctatgagctcccagatggctcagtcgtcatcaatgcccga
aaccagaacaactaccactgccactgccgaattgtcctccgcagctatgatgcctgtgat
acactaaggccccgtgatgtgaccttcgaccctgagctcgtggaccctgtggtagctgca
ggagctgtagtcaccagctccggcattgtcttcttctccaacccagcacatccagagttc
cgagtgaacctgaccctgcgatggagcttcagcaatggtacctcatggcggaaagagaca
gtccagctatggccaggccccagtggctattcatccctggcaaccctggagggcagcatg
gatggagaggagcaggccccccagctctacgtcctgtatgagaaaggccggaaccactac
acagagagcatctccgtggccaaaatcagtgtctatgggacactctga

KEGG   Homo sapiens (human): 4759Help
Entry
4759              CDS       T01001                                 

Gene name
NEU2, SIAL2
Definition
(RefSeq) neuraminidase 2
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00511  Other glycan degradation
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4759 (NEU2)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    4759 (NEU2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     4759 (NEU2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR
Motif
Other DBs
NCBI-GeneID: 4759
NCBI-ProteinID: NP_005374
OMIM: 605528
HGNC: 7759
Ensembl: ENSG00000115488
Vega: OTTHUMG00000133274
Pharos: Q9Y3R4(Tbio)
UniProt: Q9Y3R4
LinkDB All DBs
Structure
PDB: 

Position
2q37.1
AA seq 380 aa AA seqDB search
MASLPVLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYD
APTHQVQWQAQEVVAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRAN
VTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLHDRARSLVVPAYA
YRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHL
RARVQAQSTNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTH
SWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLFGCLYEANDYE
EIVFLMFTLKQAFPAEYLPQ
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcccttcctgtcctgcagaaggagagcgtgttccagtcgggagcccatgcctac
agaatccctgccctgctctacctgcctgggcagcagtccctgctggccttcgcggaacag
cgggcaagcaagaaggatgagcacgcagagctgattgtcctgcgcagaggagactacgac
gcacccacccaccaggttcagtggcaagctcaggaggtggtggcccaggcccggctggat
ggccaccggtccatgaacccatgccccttgtatgacgcgcagacggggaccctcttcctc
ttcttcattgccatccctgggcaagtcacggagcaacagcagctgcagaccagggccaat
gtgacgcggctgtgccaagtcaccagcactgaccacgggaggacctggagctcccccaga
gacctcactgatgcggccatcggcccagcctaccgggagtggtccacctttgcagtgggc
ccggggcattgtttgcagcttcacgacagggcccggagcctggtggtgcccgcctacgcc
taccggaaacttcaccccatccaaaggccgatcccctctgccttctgcttcctcagccat
gaccatgggcgcacgtgggcgcgagggcactttgtggcccaggacaccctggagtgccag
gtggccgaagtcgagactggggagcagagggtggtgaccctcaacgcgagaagccacctc
cgagccagggtccaggcccagagcaccaatgacgggcttgatttccaggagtctcagctg
gtgaagaagctggtggagccgccgccccagggctgccaggggagcgtcatcagcttcccc
agcccccgctcggggcctggctccccagcccagtggctgctctacactcaccccacacac
tcctggcagagggccgacctgggtgcctacctcaacccgcgacctccagcccctgaggcc
tggtcagagccggtactgctggccaagggcagctgtgcctactcagacctccagagcatg
ggcaccggccctgatgggtcccccttgtttgggtgtctgtacgaagccaatgattacgag
gagattgtctttctcatgttcaccctgaagcaagccttcccagctgagtacctgcctcag
tga

DBGET integrated database retrieval system