KEGG   Homo sapiens (human): 10846
Entry
10846             CDS       T01001                                 

Gene name
PDE10A, ADSD2, HSPDE10A, IOLOD, LINC00473, PDE10A19
Definition
(RefSeq) phosphodiesterase 10A
  KO
K18438  cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10 [EC:3.1.4.17 3.1.4.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04024  cAMP signaling pathway
hsa05032  Morphine addiction
Disease
H01570  Autosomal dominant striatal degeneration
H02388  Infantile-onset limb and orofacial dyskinesia
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Balipodect: D11245
Bemoradan: D03075
Bucladesine (DG00230): D01238<JP> D07546
Choline theophyllinate: D02017
Diprophylline: D00691<JP>
Enprofylline: D04006
Flavoxate (DG00477): D00718<JP/US> D07961
Mardepodect: D11171
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Prinoxodan: D05612
Proxyphylline: D01771<JP>
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    10846 (PDE10A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    10846 (PDE10A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    10846 (PDE10A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     10846 (PDE10A)
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     10846 (PDE10A)
SSDB
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3 SpoVT_C HD H_kinase_N
Other DBs
NCBI-GeneID: 10846
NCBI-ProteinID: NP_006652
OMIM: 610652
HGNC: 8772
Ensembl: ENSG00000112541
Vega: OTTHUMG00000015986
Pharos: Q9Y233(Tclin)
UniProt: Q9Y233 A0A1B1UZR0
LinkDB
Structure
PDB: 

Position
6q27
AA seq 779 aa
MRIEERKSQHLTGLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRKNNKSEDESAP
KEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGEC
NNSLCIFTPPGIKEGKPRLIPAGPITQGTTVSAYVAKSRKTLLVEDILGDERFPRGTGLE
SGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWASVAIHQVQVC
RGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELY
SDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYT
GYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYHR
IRHSECIYRVTMEKLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIF
VYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTD
LERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNI
FSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMM
TACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFY
NAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSVAQKAAASED
NT seq 2340 nt   +upstreamnt  +downstreamnt
atgaggatagaagagaggaaatcccaacatttaacaggtttgacagatgaaaaagtgaag
gcatatctttctcttcacccccaggtattagatgaatttgtatctgaaagtgttagtgca
gagacagtagagaaatggctgaagaggaagaacaacaaatcagaagatgaatcagctcct
aaggaagtcagcaggtaccaagatacgaatatgcagggagttgtatatgaactaaacagc
tatatagaacaacggttggacacaggaggagacaaccagctactcctctatgaactgagc
agcatcattaaaatagccacaaaagccgatggatttgcactgtatttccttggagagtgc
aataatagcctgtgtatattcacgccacctgggataaaggaaggaaaaccccgcctcatc
cctgctgggcccatcactcagggcaccaccgtctctgcttatgtggccaagtccaggaaa
acactgctagtagaagacatccttggagatgaacgatttccaagaggtactggactggaa
tcagggactcgtatccagtctgttctttgcttaccaattgtcactgcaattggtgacttg
attggtattctcgagctgtatcggcactggggcaaagaagccttctgtcttagtcaccag
gaggttgcaacagcaaatcttgcctgggcttcagtagcaatacatcaggtgcaggtatgc
agaggccttgccaaacagacagaattgaatgacttcctactcgacgtatcaaaaacatat
tttgataacatagttgcaatagattctctacttgaacacataatgatatatgcaaaaaac
ctggtgaatgccgatcgttgtgcgcttttccaggtggaccataagaacaaggagttatat
tcagacctttttgatattggagaggaaaaggaaggaaaacctgtcttcaagaagaccaaa
gagataagattttcaattgagaaaggaattgctggccaagtagcaagaacaggggaagtc
ctgaacattccagatgcctatgcagacccacgctttaacagagaagtagacttgtacaca
ggctacaccacgcggaacatcctgtgcatgcccatcgtcagccgaggcagcgtgataggt
gtggtgcagatggtcaacaaaatcagtggcagtgccttctctaaaacagatgaaaacaac
ttcaaaatgtttgccgtcttttgtgctttagccttacactgtgctaatatgtatcataga
attcgccactcagagtgcatttaccgggtaacgatggaaaagctgtcctaccatagcatt
tgtacttcagaagagtggcaaggtctcatgcaattcacccttcccgtgcgtctctgcaaa
gaaattgaattattccactttgacattggtccttttgaaaacatgtggcctggaattttt
gtctacatggttcatcggtcctgtgggacatcctgctttgagcttgaaaagttgtgtcgt
tttattatgtctgtgaagaagaactatcggcgggttccttatcacaactggaagcatgcg
gtcactgtagcacactgcatgtatgccatacttcagaacaatcacacgcttttcacagac
cttgagcgcaaaggactgctgattgcgtgtctgtgtcatgacctggaccacaggggcttc
agtaacagctacctgcagaagttcgaccaccctctggccgctctctactccacttccacc
atggagcagcaccacttctcccagactgtgtccatcctccagttggaagggcacaatatc
ttctccactctgagctccagtgaatatgagcaggtgcttgagatcatccgcaaagccatc
attgccacagaccttgctttatactttggaaacaggaagcagttggaagagatgtaccag
accggatcactaaaccttaataatcaatcacatagagaccgtgtaattggtttgatgatg
actgcctgtgacctttgttctgtgacaaaactgtggcccgttacaaaattgacggcaaat
gatatatatgcagaattctgggctgagggtgatgaaatgaagaaattgggaatacagcct
attcctatgatggacagagacaagaaggatgaagtcccccaaggccagcttgggttctac
aatgccgtggccattccctgctatacaacccttacccagatcctccctcccacggagcct
cttctgaaagcatgcagggataatctcagtcagtgggagaaggtgattcgaggggaggag
actgcaacctggatttcatccccatccgtggctcagaaggcagctgcatctgaagattga

KEGG   Homo sapiens (human): 27115
Entry
27115             CDS       T01001                                 

Gene name
PDE7B, bA472E5.1
Definition
(RefSeq) phosphodiesterase 7B
  KO
K18436  high affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Bemoradan: D03075
Bucladesine (DG00230): D01238<JP> D07546
Choline theophyllinate: D02017
Diprophylline: D00691<JP>
Enprofylline: D04006
Flavoxate (DG00477): D00718<JP/US> D07961
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Prinoxodan: D05612
Proxyphylline: D01771<JP>
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    27115 (PDE7B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    27115 (PDE7B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     27115 (PDE7B)
SSDB
Motif
Pfam: PDEase_I
Other DBs
NCBI-GeneID: 27115
NCBI-ProteinID: NP_061818
OMIM: 604645
HGNC: 8792
Ensembl: ENSG00000171408
Vega: OTTHUMG00000015641
Pharos: Q9NP56(Tclin)
UniProt: Q9NP56
LinkDB
Position
6q23.3
AA seq 450 aa
MSCLMVERCGEILFENPDQNAKCVCMLGDIRLRGQTGVRAERRGSYPFIDFRLLNSTTYS
GEIGTKKKVKRLLSFQRYFHASRLLRGIIPQAPLHLLDEDYLGQARHMLSKVGMWDFDIF
LFDRLTNGNSLVTLLCHLFNTHGLIHHFKLDMVTLHRFLVMVQEDYHSQNPYHNAVHAAD
VTQAMHCYLKEPKLASFLTPLDIMLGLLAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMS
VLENHHWRSTIGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN
KDLRLEDAQDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGELEQKFELEIS
PLCNQQKDSIPSIQIGFMSYIVEPLFREWAHFTGNSTLSENMLGHLAHNKAQWKSLLPRQ
HRSRGSSGSGPDHDHAGQGTESEEQEGDSP
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgtcttgtttaatggttgagaggtgtggcgaaatcttgtttgagaaccccgatcagaat
gccaaatgtgtttgcatgctgggagatatacgactaaggggtcagacgggggttcgtgct
gaacgccgtggctcctacccattcattgacttccgcctacttaacagtacaacatactca
ggggagattggcaccaagaaaaaggtgaaaagactattaagctttcaaagatacttccat
gcatcaaggctgcttcgtggaattataccacaagcccctctgcacctgctggatgaagac
taccttggacaagcaaggcatatgctctccaaagtgggaatgtgggattttgacattttc
ttgtttgatcgcttgacaaatggaaacagcctggtaacactgttgtgccacctcttcaat
acccatggactcattcaccatttcaagttagatatggtgaccttacaccgatttttagtc
atggttcaagaagattaccacagccaaaacccgtatcacaatgctgttcacgcagccgac
gtcacccaggccatgcactgctacctgaaagagccaaagcttgccagcttcctcacgcct
ctggacatcatgcttggactgctggctgcagcagcacacgatgtggaccacccaggggtg
aaccagccatttttgataaaaactaaccaccatcttgcaaacctatatcagaatatgtct
gtgctggagaatcatcactggcgatctacaattggcatgcttcgagaatcaaggcttctt
gctcatttgccaaaggaaatgacacaggatattgaacagcagctgggctccttgatcttg
gcaacagacatcaacaggcagaatgaatttttgaccagattgaaagctcacctccacaat
aaagacttaagactggaggatgcacaggacaggcactttatgcttcagatcgccttgaag
tgtgctgacatttgcaatccttgtagaatctgggagatgagcaagcagtggagtgaaagg
gtctgtgaagaattctacaggcaaggtgaacttgaacagaaatttgaactggaaatcagt
cctctttgtaatcaacagaaagattccatccctagtatacaaattggtttcatgagctac
atcgtggagccgctcttccgggaatgggcccatttcacgggtaacagcaccctgtcggag
aacatgctgggccacctcgcacacaacaaggcccagtggaagagcctgttgcccaggcag
cacagaagcaggggcagcagtggcagcgggcctgaccacgaccacgcaggccaagggact
gagagcgaggagcaggaaggcgacagcccctag

KEGG   Homo sapiens (human): 50940
Entry
50940             CDS       T01001                                 

Gene name
PDE11A, PPNAD2
Definition
(RefSeq) phosphodiesterase 11A
  KO
K13298  dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 [EC:3.1.4.17 3.1.4.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04934  Cushing syndrome
hsa05032  Morphine addiction
Network
nt06310  CRH-ACTH-cortisol signaling
nt06360  Cushing syndrome
  Element
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
Disease
H00260  Pigmented micronodular adrenocortical disease
H01431  Cushing syndrome
H02049  Bilateral macronodular adrenal hyperplasia
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Bemoradan: D03075
Bucladesine (DG00230): D01238<JP> D07546
Choline theophyllinate: D02017
Diprophylline: D00691<JP>
Enprofylline: D04006
Flavoxate (DG00477): D00718<JP/US> D07961
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Prinoxodan: D05612
Proxyphylline: D01771<JP>
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    50940 (PDE11A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    50940 (PDE11A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    50940 (PDE11A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     50940 (PDE11A)
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     50940 (PDE11A)
SSDB
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3 HD
Other DBs
NCBI-GeneID: 50940
NCBI-ProteinID: NP_058649
OMIM: 604961
HGNC: 8773
Ensembl: ENSG00000128655 ENSG00000284741
Vega: OTTHUMG00000154188
Pharos: Q9HCR9(Tchem)
UniProt: Q9HCR9
LinkDB
Position
2q31.2
AA seq 933 aa
MAASRLDFGEVETFLDRHPELFEDYLMRKGKQEMVEKWLQRHSQGQGALGPRPSLAGTSS
LAHSTCRGGSSVGGGTGPNGSAHSQPLPGGGDCGGVPLSPSWAGGSRGDGNLQRRASQKE
LRKSFARSKAIHVNRTYDEQVTSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRV
NLPRYPPTAIDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCSL
FLVEGAAAGKKTLVSKFFDVHAGTPLLPCSSTENSNEVQVPWGKGIIGYVGEHGETVNIP
DAYQDRRFNDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKIPEGAPFTEDDEKVMQ
MYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKC
ERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVA
STGLPVNISDAYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFD
DADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANI
PLVSELAIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRM
VLYHNWRHAFNVCQLMFAMLTTAGFQDILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSG
SALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLY
FERRTEFFELVSKGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFE
QGDRERLELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNVKLKPMLDSVAT
NRSKWEELHQKRLLASTASSSPASVMVAKEDRN
NT seq 2802 nt   +upstreamnt  +downstreamnt
atggcagcctcccgcctggactttggggaggtggaaactttcctggacaggcacccagag
ttgtttgaagattacttgatgcggaaggggaagcaggagatggttgaaaagtggctgcag
aggcacagtcagggtcagggggctttaggtccaaggccctctttggctggtaccagcagc
ttggctcacagcacctgcagaggtggcagcagcgttggtggtggcactggaccaaatggc
tctgcccacagccagccccttcccggtggcggggactgtggtggggttcccttgagtccc
agctgggccggtggcagcaggggcgatgggaacctgcagcggagagcttctcagaaagag
ctaaggaagagttttgcccgctccaaggccatccacgtgaacaggacctacgatgaacag
gtgacctcccgggctcaggaacccctgagtagtgtacgacggagggcacttctccggaag
gcaagctccctgccccccaccacagcccatattctcagtgcgctgctggaatcgagagtg
aatctgcctcggtatccccctacagccatcgactacaagtgccatctgaaaaagcataat
gagcgtcagttctttctggaattggtcaaagatatctccaatgaccttgacctcaccagc
ctgagctacaagattctcatctttgtctgccttatggtggatgctgaccgctgctctctt
ttcctggtggaaggggcagctgctggcaagaagaccttggtctccaaattctttgatgtg
catgcaggaacacctctgctgccttgcagcagcacagagaactcaaatgaggtgcaggtc
ccctggggcaaaggtatcattggctatgtcggggagcatggagaaacggtcaacattcct
gatgcctaccaggatcgacgattcaatgatgaaatcgacaagctaactggatacaagaca
aaatcattattgtgcatgcctatccgaagcagtgatggtgagattattggtgtggcccaa
gcgataaataagattcctgaaggagctccatttactgaagatgatgaaaaagttatgcag
atgtatcttccattttgtggaatcgccatatctaacgctcagctctttgctgcctcaagg
aaagaatatgaaagaagcagagctttgctagaggtggttaatgacctctttgaagaacag
actgacctggagaaaattgtcaagaaaataatgcatcgggcccaaactctgctgaaatgt
gaacgctgttctgttttactcctagaggacatcgaatcaccagtggtgaaatttaccaaa
tcctttgaattgatgtccccaaagtgcagtgctgatgctgagaacagtttcaaagaaagc
atggagaaatcatcatactccgactggctaataaataacagcattgctgagctggttgct
tcaacaggccttccagtgaacatcagtgatgcctaccaggatccgcgctttgatgcagag
gcagaccagatatctggttttcacataagatctgttctttgtgtccctatttggaatagc
aaccaccaaataattggagtggctcaagtgttaaacagacttgatgggaaaccttttgat
gatgcagatcaacgactttttgaggcttttgtcatcttttgtggacttggcatcaacaac
acaattatgtatgatcaagtgaagaagtcctgggccaagcagtctgtggctcttgatgtg
ctatcataccatgcaacatgttcaaaagctgaagttgacaagtttaaggcagccaacatc
cctctggtgtcagaacttgccatcgatgacattcattttgatgacttttctctcgacgtt
gatgccatgatcacagctgctctccggatgttcatggagctggggatggtacagaaattt
aaaattgactatgagacactgtgtaggtggcttttgacagtgaggaaaaactatcggatg
gttctataccacaactggagacatgccttcaacgtgtgtcagctgatgttcgcgatgtta
accactgctgggtttcaagacattctgaccgaggtggaaattttagcggtgattgtggga
tgcctgtgtcatgacctcgaccacaggggaaccaacaatgccttccaagctaagagtggc
tctgccctggcccaactctatggaacctctgctaccttggagcatcaccatttcaaccac
gccgtgatgatccttcaaagtgagggtcacaatatctttgctaacctgtcctccaaggaa
tatagtgaccttatgcagcttttgaagcagtcaatattggcaacagacctcacgctgtac
tttgagaggagaactgaattctttgaacttgtcagtaaaggagaatacgattggaacatc
aaaaaccatcgtgatatatttcgatcaatgttaatgacagcctgtgaccttggagccgtg
accaaaccgtgggagatctccagacaggtggcagaacttgtaaccagtgagttcttcgaa
caaggagatcgggagagattagagctcaaactcactccttcagcaatttttgatcggaac
cggaaggatgaactgcctcggttgcaactggagtggattgatagcatctgcatgcctttg
tatcaggcactggtgaaggtcaacgtgaaactgaagccgatgctagattcagtagctaca
aacagaagtaagtgggaagagctacaccaaaaacgactgctggcctcaactgcctcatcc
tcccctgccagtgttatggtagccaaggaagacaggaactaa

KEGG   Homo sapiens (human): 5136
Entry
5136              CDS       T01001                                 

Gene name
PDE1A, CAM-PDE_1A, CAM-PDE-1A, HCAM-1, HCAM1, HSPDE1A
Definition
(RefSeq) phosphodiesterase 1A
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04740  Olfactory transduction
hsa04742  Taste transduction
hsa04924  Renin secretion
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Bemoradan: D03075
Bucladesine (DG00230): D01238<JP> D07546
Choline theophyllinate: D02017
Diprophylline: D00691<JP>
Enprofylline: D04006
Flavoxate (DG00477): D00718<JP/US> D07961
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Prinoxodan: D05612
Proxyphylline: D01771<JP>
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5136 (PDE1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    5136 (PDE1A)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    5136 (PDE1A)
  09157 Sensory system
   04740 Olfactory transduction
    5136 (PDE1A)
   04742 Taste transduction
    5136 (PDE1A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5136 (PDE1A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     5136 (PDE1A)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N
Other DBs
NCBI-GeneID: 5136
NCBI-ProteinID: NP_001003683
OMIM: 171890
HGNC: 8774
Ensembl: ENSG00000115252
Vega: OTTHUMG00000132596
Pharos: P54750(Tclin)
UniProt: P54750
LinkDB
Position
2q32.1
AA seq 535 aa
MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGILRCLVKQLERGDVNVVDLKKNIEYAA
SVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLASTFTRKMGMTKKKPEEKPKFRS
IVHAVQAGIFVERMYRKTYHMVGLAYPAAVIVTLKDVDKWSFDVFALNEASGEHSLKFMI
YELFTRYDLINRFKIPVSCLITFAEALEVGYSKYKNPYHNLIHAADVTQTVHYIMLHTGI
MHWLTELEILAMVFAAAIHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRLM
QEEEMNILINLSKDDWRDLRNLVIEMVLSTDMSGHFQQIKNIRNSLQQPEGIDRAKTMSL
ILHAADISHPAKSWKLHYRWTMALMEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGF
IDFIVEPTFSLLTDSTEKIVIPLIEEASKAETSSYVASSSTTIVGLHIADALRRSNTKGS
MSDGSYSPDYSLAAVDLKSFKNNLVDIIQQNKERWKELAAQEARTSSQKCEFIHQ
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggggtctagtgccacagagattgaagaattggaaaacaccacttttaagtatcttaca
ggagaacagactgaaaaaatgtggcagcgcctgaaaggaatactaagatgcttggtgaag
cagctggaaagaggtgatgttaacgtcgtcgacttaaagaagaatattgaatatgcggca
tctgtgctggaagcagtttatatcgatgaaacaagaagacttctggatactgaagatgag
ctcagtgacattcagactgactcagtcccatctgaagtccgggactggttggcttctacc
tttacacggaaaatggggatgacaaaaaagaaacctgaggaaaaaccaaaatttcggagc
attgtgcatgctgttcaagctggaatttttgtggaaagaatgtaccgaaaaacatatcat
atggttggtttggcatatccagcagctgtcatcgtaacattaaaggatgttgataaatgg
tctttcgatgtatttgccctaaatgaagcaagtggagagcatagtctgaagtttatgatt
tatgaactgtttaccagatatgatcttatcaaccgtttcaagattcctgtttcttgccta
atcacctttgcagaagctttagaagttggttacagcaagtacaaaaatccatatcacaat
ttgattcatgcagctgatgtcactcaaactgtgcattacataatgcttcatacaggtatc
atgcactggctcactgaactggaaattttagcaatggtctttgctgctgccattcatgat
tatgagcatacagggacaacaaacaactttcacattcagacaaggtcagatgttgccatt
ttgtataatgatcgctctgtccttgagaatcaccacgtgagtgcagcttatcgacttatg
caagaagaagaaatgaatatcttgataaatttatccaaagatgactggagggatcttcgg
aacctagtgattgaaatggttttatctacagacatgtcaggtcacttccagcaaattaaa
aatataagaaacagtttgcagcagcctgaagggattgacagagccaaaaccatgtccctg
attctccacgcagcagacatcagccacccagccaaatcctggaagctgcattatcggtgg
accatggccctaatggaggagtttttcctgcagggagataaagaagctgaattagggctt
ccattttccccactttgtgatcggaagtcaaccatggtggcccagtcacaaataggtttc
atcgatttcatagtagagccaacattttctcttctgacagactcaacagagaaaattgtt
attcctcttatagaggaagcctcaaaagccgaaacttcttcctatgtggcaagcagctca
accaccattgtggggttacacattgctgatgcactaagacgatcaaatacaaaaggctcc
atgagtgatgggtcctattccccagactactcccttgcagcagtggacctgaagagtttc
aagaacaacctggtggacatcattcagcagaacaaagagaggtggaaagagttagctgca
caagaagcaagaaccagttcacagaagtgtgagtttattcatcagtaa

KEGG   Homo sapiens (human): 5137
Entry
5137              CDS       T01001                                 

Gene name
PDE1C, DFNA74, Hcam3, cam-PDE_1C, hCam-3
Definition
(RefSeq) phosphodiesterase 1C
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04740  Olfactory transduction
hsa04742  Taste transduction
hsa04924  Renin secretion
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Bemoradan: D03075
Bucladesine (DG00230): D01238<JP> D07546
Choline theophyllinate: D02017
Diprophylline: D00691<JP>
Enprofylline: D04006
Flavoxate (DG00477): D00718<JP/US> D07961
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Prinoxodan: D05612
Proxyphylline: D01771<JP>
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5137 (PDE1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    5137 (PDE1C)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    5137 (PDE1C)
  09157 Sensory system
   04740 Olfactory transduction
    5137 (PDE1C)
   04742 Taste transduction
    5137 (PDE1C)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5137 (PDE1C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     5137 (PDE1C)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N
Other DBs
NCBI-GeneID: 5137
NCBI-ProteinID: NP_001177986
OMIM: 602987
HGNC: 8776
Ensembl: ENSG00000154678
Vega: OTTHUMG00000023836
Pharos: Q14123(Tclin)
UniProt: Q14123
LinkDB
Position
7p14.3
AA seq 709 aa
MESPTKEIEEFESNSLKYLQPEQIEKIWLRLRGLRKYKKTSQRLRSLVKQLERGEASVVD
LKKNLEYAATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRR
SDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIEALKDVDKWSFDVFSLNEAS
GDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTV
HYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENH
HLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPE
AIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKS
TMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR
SGVKTSGSEGSAPINNSVISVDYKSFKATWTEVVHINRERWRAKVPKEEKAKKEAEEKAR
LAAEEQQKEMEAKSQAEEGASGKAEKKTSGETKNQVNGTRANKSDNPRGKNSKAEKSSGE
QQQNGDFKDGKNKTDKKDHSNIGNDSKKTDGTKQRSHGSPAPSTSSTCRLTLPVIKPPLR
HFKRPAYASSSYAPSVSKKTDEHPARYKMLDQRIKMKKIQNISHNWNRK
NT seq 2130 nt   +upstreamnt  +downstreamnt
atggagtcgccaaccaaggagattgaagaatttgagagcaactctctgaaatacctgcaa
ccggaacagatcgagaaaatctggcttcggctccgcgggctgaggaaatataagaaaacg
tcccagagattacggtctttggtcaaacaattagagagaggggaagcttcagtggtagat
cttaagaagaatttggaatatgcagccacagtgcttgaatctgtgtatattgatgaaaca
aggagactcctggatacagaggatgagctcagtgacattcagtcagatgctgtgccttct
gaggtccgagactggctggcctccaccttcacgcggcagatggggatgatgctcaggagg
agcgacgagaagccccggttcaagagcatcgttcacgcagtgcaggctgggatatttgtg
gagagaatgtatagacggacatcaaacatggttggactgagctatccaccagctgttatt
gaggcattaaaggatgtggacaagtggtcctttgacgtcttttccctcaatgaggccagt
ggggatcatgcactgaaatttattttctatgaactactcacacgttatgatctgatcagc
cgtttcaagatccccatttctgcacttgtctcatttgtggaggccctggaagtgggatac
agcaagcacaaaaatccttaccataacttaatgcacgctgccgatgttacacagacagtg
cattacctcctctataagacaggagtggcgaactggctgacggagctggagatctttgct
ataatcttctcagctgccatccatgactacgagcataccggaaccaccaacaatttccac
attcagactcggtctgatccagctattctgtataatgacagatctgtactggagaatcac
catttaagtgcagcttatcgccttctgcaagatgacgaggaaatgaatattttgattaac
ctctcaaaggatgactggagggagtttcgaaccttggtaattgaaatggtgatggccaca
gatatgtcttgtcacttccaacaaatcaaagcaatgaagactgctctgcagcagccagaa
gccattgaaaagccaaaagccttatcccttatgctgcatacagcagatattagccatcca
gcaaaagcatgggacctccatcatcgctggacaatgtcactcctggaggagttcttcaga
cagggtgacagagaagcagagctggggctgcctttttctcctctgtgtgaccgaaagtcc
actatggttgctcagtcacaagtaggtttcattgatttcatcgtggaacccaccttcact
gtgcttacggacatgaccgagaagattgtgagtccattaatcgatgaaacctctcaaact
ggtgggacaggacagaggcgttcgagtttgaatagcatcagctcgtcagatgccaagcga
tcaggtgtcaagacctctggttcagagggaagtgccccgatcaacaattctgtcatctcc
gttgactataagagctttaaagctacttggacggaagtggtgcacatcaatcgggagaga
tggagggccaaggtacccaaagaggagaaggccaagaaggaagcagaggaaaaggctcgc
ctggccgcagaggagcagcaaaaggaaatggaagccaaaagccaggctgaagaaggcgca
tctggcaaagctgagaaaaagacgtctggagaaactaagaatcaagtcaatggaacacgg
gcaaacaaaagtgacaaccctcgtgggaaaaactccaaagccgagaagtcatcaggagaa
cagcaacagaatggtgacttcaaagatggtaaaaataagacagacaagaaggatcactct
aacatcggaaatgattcaaagaaaacagatggcacaaaacagcgttctcacggctcacca
gccccaagcaccagctccacgtgtcgccttacgttgccagtcatcaagcctcctttgcgt
cattttaaacgccctgcttacgcatctagctcctatgcaccttcagtctcaaagaaaact
gatgagcatcctgcaaggtacaagatgctggatcagaggatcaaaatgaaaaagattcag
aacatctcacataactggaacagaaaatag

KEGG   Homo sapiens (human): 5138
Entry
5138              CDS       T01001                                 

Gene name
PDE2A, CGS-PDE, PDE2A1, PED2A4, cGSPDE
Definition
(RefSeq) phosphodiesterase 2A
  KO
K18283  cGMP-dependent 3',5'-cyclic phosphodiesterase [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04022  cGMP-PKG signaling pathway
hsa04740  Olfactory transduction
hsa04925  Aldosterone synthesis and secretion
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Bemoradan: D03075
Bucladesine (DG00230): D01238<JP> D07546
Caffeine (DG00974): D00528<JP> D01453<JP> D07603<US>
Choline theophyllinate: D02017
Diprophylline: D00691<JP>
Doxofylline: D03898
Enprofylline: D04006
Flavoxate (DG00477): D00718<JP/US> D07961
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Prinoxodan: D05612
Proxyphylline: D01771<JP>
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5138 (PDE2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    5138 (PDE2A)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    5138 (PDE2A)
  09157 Sensory system
   04740 Olfactory transduction
    5138 (PDE2A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5138 (PDE2A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     5138 (PDE2A)
SSDB
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3
Other DBs
NCBI-GeneID: 5138
NCBI-ProteinID: NP_002590
OMIM: 602658
HGNC: 8777
Ensembl: ENSG00000186642
Vega: OTTHUMG00000102045
Pharos: O00408(Tclin)
UniProt: O00408 Q8IW54
LinkDB
Structure
PDB: 

Position
11q13.4
AA seq 941 aa
MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPPQPCADSLQDALLSLGSVIDI
SGLQRAVKEALSAVLPRVETVYTYLLDGESQLVCEDPPHELPQEGKVREAIISQKRLGCN
GLGFSDLPGKPLARLVAPLAPDTQVLVMPLADKEAGAVAAVILVHCGQLSDNEEWSLQAV
EKHTLVALRRVQVLQQRGPREAPRAVQNPPEGTAEDQKGGAAYTDRDRKILQLCGELYDL
DASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGCLGQVV
EDKKSIQLKDLTSEDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLEGDLFTD
EDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITE
ARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPD
AYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAF
SIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNF
ASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMH
AFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYS
SEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDL
QKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAM
GNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSH
KFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDAE
NT seq 2826 nt   +upstreamnt  +downstreamnt
atggggcaggcatgcggccactccatcctctgcaggagccagcagtacccggcagcgcga
ccggctgagccgcggggccagcaggtcttcctcaagccggacgagccgccgccgccgccg
cagccatgcgccgacagcctgcaggacgccttgctgagtctgggctctgtcatcgacatt
tcaggcctgcaacgtgctgtcaaggaggccctgtcagctgtgctcccccgagtggaaact
gtctacacctacctactggatggtgagtcccagctggtgtgtgaggaccccccacatgag
ctgccccaggaggggaaagtccgggaggctatcatctcccagaagcggctgggctgcaat
gggctgggcttctcagacctgccagggaagcccttggccaggctggtggctccactggct
cctgatacccaagtgctggtcatgccgctagcggacaaggaggctggggccgtggcagct
gtcatcttggtgcactgtggccagctgagtgataatgaggaatggagcctgcaggcggtg
gagaagcataccctggtcgccctgcggagggtgcaggtcctgcagcagcgcgggcccagg
gaggctccccgagccgtccagaaccccccggaggggacggcggaagaccagaagggcggg
gcggcgtacaccgaccgcgaccgcaagatcctccaactgtgcggggaactctacgacctg
gatgcctcttccctgcagctcaaagtgctccaatacctgcagcaggagacccgggcatcc
cgctgctgcctcctgctggtgtcggaggacaatctccagctttcttgcaaggtcatcgga
gacaaagtgctcggggaagaggtcagctttcccttgacaggatgcctgggccaggtggtg
gaagacaagaagtccatccagctgaaggacctcacctccgaggatgtacaacagctgcag
agcatgttgggctgtgagctgcaggccatgctctgtgtccctgtcatcagccgggccact
gaccaggtggtggccttggcctgcgccttcaacaagctagaaggagacttgttcaccgac
gaggacgagcatgtgatccagcactgcttccactacaccagcaccgtgctcaccagcacc
ctggccttccagaaggaacagaaactcaagtgtgagtgccaggctcttctccaagtggca
aagaacctcttcacccacctggatgacgtctctgtcctgctccaggagatcatcacggag
gccagaaacctcagcaacgcagagatctgctctgtgttcctgctggatcagaatgagctg
gtggccaaggtgttcgacgggggcgtggtggatgatgagagctatgagatccgcatcccg
gccgatcagggcatcgcgggacacgtggcgaccacgggccagatcctgaacatccctgac
gcatatgcccatccgcttttctaccgcggcgtggacgacagcaccggcttccgcacgcgc
aacatcctctgcttccccatcaagaacgagaaccaggaggtcatcggtgtggccgagctg
gtgaacaagatcaatgggccatggttcagcaagttcgacgaggacctggcgacggccttc
tccatctactgcggcatcagcatcgcccattctctcctatacaaaaaagtgaatgaggct
cagtatcgcagccacctggccaatgagatgatgatgtaccacatgaaggtctccgatgat
gagtataccaaacttctccatgatgggatccagcctgtggctgccattgactccaatttt
gcaagtttcacctatacccctcgttccctgcccgaggatgacacgtccatggccatcctg
agcatgctgcaggacatgaatttcatcaacaactacaaaattgactgcccgaccctggcc
cggttctgtttgatggtgaagaagggctaccgggatcccccctaccacaactggatgcac
gccttttctgtctcccacttctgctacctgctctacaagaacctggagctcaccaactac
ctcgaggacatcgagatctttgccttgtttatttcctgcatgtgtcatgacctggaccac
agaggcacaaacaactctttccaggtggcctcgaaatctgtgctggctgcgctctacagc
tctgagggctccgtcatggagaggcaccactttgctcaggccatcgccatcctcaacacc
cacggctgcaacatctttgatcatttctcccggaaggactatcagcgcatgctggatctg
atgcgggacatcatcttggccacagacctggcccaccatctccgcatcttcaaggacctc
cagaagatggctgaggtgggctacgaccgaaacaacaagcagcaccacagacttctcctc
tgcctcctcatgacctcctgtgacctctctgaccagaccaagggctggaagactacgaga
aagatcgcggagctgatctacaaagaattcttctcccagggagacctggagaaggccatg
ggcaacaggccgatggagatgatggaccgggagaaggcctatatccctgagctgcaaatc
agcttcatggagcacattgcaatgcccatctacaagctgttgcaggacctgttccccaaa
gcggcagagctgtacgagcgcgtggcctccaaccgtgagcactggaccaaggtgtcccac
aagttcaccatccgcggcctcccaagtaacaactcgctggacttcctggatgaggagtac
gaggtgcctgatctggatggcactagggcccccatcaatggctgctgcagccttgatgct
gagtga

KEGG   Homo sapiens (human): 5139
Entry
5139              CDS       T01001                                 

Gene name
PDE3A, CGI-PDE, CGI-PDE_A, CGI-PDE-A, HTNB
Definition
(RefSeq) phosphodiesterase 3A
  KO
K19021  cGMP-inhibited 3',5'-cyclic phosphodiesterase A [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04924  Renin secretion
hsa05032  Morphine addiction
Disease
H00482  Brachydactyly
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Amrinone (DG00228): D00231 D02084
Anagrelide (DG00727): D02933 D07455 D10255<JP/US>
Bemoradan: D03075
Beradilol monoethyl maleate: D09843
Bucladesine (DG00230): D01238<JP> D07546
Caffeine (DG00974): D00528<JP> D01453<JP> D07603<US>
Choline theophyllinate: D02017
Cilostazol: D01896<JP/US>
Diprophylline: D00691<JP>
Enoximone: D04004
Enprofylline: D04006
Ensifentrine: D11743
Flavoxate (DG00477): D00718<JP/US> D07961
Ibudilast: D01385<JP>
Imazodan hydrochloride: D04508
Indolidan: D04529
Isomazole hydrochloride: D04628
Levosimendan: D04720
Lixazinone sulfate: D04751
Milrinone (DG00229): D00417<JP> D02085<US>
Moxaverine (DG00045): D07089 D08238
Olprinone (DG01396): D02042<JP> D08294
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Pimobendan: D01133<JP>
Piroximone: D05514
Prinoxodan: D05612
Proxyphylline: D01771<JP>
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Toborinone: D01198
Trapidil: D01220<JP>
Vesnarinone: D01690
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5139 (PDE3A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    5139 (PDE3A)
   04022 cGMP-PKG signaling pathway
    5139 (PDE3A)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    5139 (PDE3A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5139 (PDE3A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     5139 (PDE3A)
SSDB
Motif
Pfam: PDEase_I
Other DBs
NCBI-GeneID: 5139
NCBI-ProteinID: NP_000912
OMIM: 123805
HGNC: 8778
Ensembl: ENSG00000172572
Vega: OTTHUMG00000168962
Pharos: Q14432(Tclin)
UniProt: Q14432
LinkDB
Position
12p12.2
AA seq 1141 aa
MAVPGDAARVRDKPVHSGVSQAPTAGRDCHHRADPASPRDSGCRGCWGDLVLQPLRSSRK
LSSALCAGSLSFLLALLVRLVRGEVGCDLEQCKEAAAAEEEEAAPGAEGGVFPGPRGGAP
GGGARLSPWLQPSALLFSLLCAFFWMGLYLLRAGVRLPLAVALLAACCGGEALVQIGLGV
GEDHLLSLPAAGVVLSCLAAATWLVLRLRLGVLMIALTSAVRTVSLISLERFKVAWRPYL
AYLAGVLGILLARYVEQILPQSAEAAPREHLGSQLIAGTKEDIPVFKRRRRSSSVVSAEM
SGCSSKSHRRTSLPCIPREQLMGHSEWDHKRGPRGSQSSGTSITVDIAVMGEAHGLITDL
LADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSDSEESSEKDKLA
IPKRLRRSLPPGLLRRVSSTWTTTTSATGLPTLEPAPVRRDRSTSIKLQEAPSSSPDSWN
NPVMMTLTKSRSFTSSYAISAANHVKAKKQSRPGALAKISPLSSPCSSPLQGTPASSLVS
KISAVQFPESADTTAKQSLGSHRALTYTQSAPDLSPQILTPPVICSSCGRPYSQGNPADE
PLERSGVATRTPSRTDDTAQVTSDYETNNNSDSSDIVQNEDETECLREPLRKASACSTYA
PETMMFLDKPILAPEPLVMDNLDSIMEQLNTWNFPIFDLVENIGRKCGRILSQVSYRLFE
DMGLFEAFKIPIREFMNYFHALEIGYRDIPYHNRIHATDVLHAVWYLTTQPIPGLSTVIN
DHGSTSDSDSDSGFTHGHMGYVFSKTYNVTDDKYGCLSGNIPALELMALYVAAAMHDYDH
PGRTNAFLVATSAPQAVLYNDRSVLENHHAAAAWNLFMSRPEYNFLINLDHVEFKHFRFL
VIEAILATDLKKHFDFVAKFNGKVNDDVGIDWTNENDRLLVCQMCIKLADINGPAKCKEL
HLQWTDGIVNEFYEQGDEEASLGLPISPFMDRSAPQLANLQESFISHIVGPLCNSYDSAG
LMPGKWVEDSDESGDTDDPEEEEEEAPAPNEEETCENNESPKKKTFKRRKIYCQITQHLL
QNHKMWKKVIEEEQRLAGIENQSLDQTPQSHSSEQIQAIKEEEEEKGKPRGEEIPTQKPD
Q
NT seq 3426 nt   +upstreamnt  +downstreamnt
atggcagtgcccggcgacgctgcacgagtcagggacaagcccgtccacagtggggtgagt
caagcccccacggcgggccgggactgccaccatcgtgcggaccccgcatcgccgcgggac
tcgggctgccgtggctgctggggagacctggtgctgcagccgctccggagctctcggaaa
ctttcctccgcgctgtgcgcgggctccctgtcctttctgctggcgctgctggtgaggctg
gtccgcggggaggtcggctgtgacctggagcagtgtaaggaggcggcggcggcggaggag
gaggaagcagccccgggagcagaagggggcgtcttcccggggcctcggggaggtgctccc
gggggcggtgcgcggctcagcccctggctgcagccctcggcgctgctcttcagtctcctg
tgtgccttcttctggatgggcttgtacctcctgcgcgccggggtgcgcctgcctctggct
gtcgcgctgctggccgcctgctgcgggggggaagcgctcgtccagattgggctgggcgtc
ggggaggatcacttactctcactccccgccgcgggggtggtgctcagctgcttggccgcc
gcgacatggctggtgctgaggctgaggctgggcgtcctcatgatcgccttgactagcgcg
gtcaggaccgtgtccctcatttccttagagaggttcaaggtcgcctggagaccttacctg
gcgtacctggccggcgtgctggggatcctcttggccaggtacgtggaacaaatcttgccg
cagtccgcggaggcggctccaagggagcatttggggtcccagctgattgctgggaccaag
gaagatatcccggtgtttaagaggaggaggcggtccagctccgtcgtgtccgccgagatg
tccggctgcagcagcaagtcccatcggaggacctccctgccctgtataccgagggaacag
ctcatggggcattcagaatgggaccacaaacgagggccaagaggatcacagtcttcagga
accagtattactgtggacatcgccgtcatgggcgaggcccacggcctcattaccgacctc
ctggcagacccttctcttccaccaaacgtgtgcacatccttgagagccgtgagcaacttg
ctcagcacacagctcaccttccaggccattcacaagcccagagtgaatcccgtcacttcg
ctcagtgaaaactatacctgttctgactctgaagagagctctgaaaaagacaagcttgct
attccaaagcgcctgagaaggagtttgcctcctggcttgttgagacgagtttcttccact
tggaccaccaccacctcggccacaggtctacccaccttggagcctgcaccagtacggaga
gaccgcagcaccagcatcaaactgcaggaagcaccttcatccagtcctgattcttggaat
aatccagtgatgatgaccctcaccaaaagcagatcctttacttcatcctatgctatttct
gcagctaaccatgtaaaggctaaaaagcaaagtcgaccaggtgccctcgctaaaatttca
cctctttcatcgccctgctcctcacctctccaagggactcctgccagcagcctggtcagc
aaaatttctgcagtgcagtttccagaatctgctgacacaactgccaaacaaagcctaggt
tctcacagggccttaacttacactcagagtgccccagacctatcccctcaaatcctgact
ccacctgttatatgtagcagctgtggcagaccatattcccaagggaatcctgctgatgag
cccctggagagaagtggggtagccactcggacaccaagtagaacagatgacactgctcaa
gttacctctgattatgaaaccaataacaacagtgacagcagtgacattgtacagaatgaa
gatgaaacagagtgcctgagagagcctctgaggaaagcatcggcttgcagcacctatgct
cctgagaccatgatgtttctggacaaaccaattcttgctcccgaacctcttgtcatggat
aacctggactcaattatggagcagctaaatacttggaattttccaatttttgatttagtg
gaaaatataggaagaaaatgtggccgtattcttagtcaggtatcttacagactttttgaa
gacatgggcctctttgaagcttttaaaattccaattagggaatttatgaattattttcat
gctttggagattggatatagggatattccttatcataacagaatccatgccactgatgtt
ttacatgctgtttggtatcttactacacagcctattccaggcctctcaactgtgattaat
gatcatggttcaaccagtgattcagattctgacagtggatttacacatggacatatggga
tatgtattctcaaaaacgtataatgtgacagatgataaatacggatgtctgtctgggaat
atccctgccttggagttgatggcgctgtatgtggctgcagccatgcacgattatgatcat
ccaggaaggactaatgctttcctggttgcaactagtgctcctcaggcggtgctatataac
gatcgttcagttttggagaatcatcacgcagctgctgcatggaatcttttcatgtcccgg
ccagagtataacttcttaattaaccttgaccatgtggaatttaagcatttccgtttcctt
gtcattgaagcaattttggccactgacctgaagaaacactttgacttcgtagccaaattt
aatggcaaggtaaatgatgatgttggaatagattggaccaatgaaaatgatcgtctactg
gtttgtcaaatgtgtataaagttggctgatatcaatggtccagctaaatgtaaagaactc
catcttcagtggacagatggtattgtcaatgaattttatgaacagggtgatgaagaggcc
agccttggattacccataagccccttcatggatcgttctgctcctcagctggccaacctt
caggaatccttcatctctcacattgtggggcctctgtgcaactcctatgattcagcagga
ctaatgcctggaaaatgggtggaagacagcgatgagtcaggagatactgatgacccagaa
gaagaggaggaagaagcaccagcaccaaatgaagaggaaacctgtgaaaataatgaatct
ccaaaaaagaagactttcaaaaggagaaaaatctactgccaaataactcagcacctctta
cagaaccacaagatgtggaagaaagtcattgaagaggagcaacggttggcaggcatagaa
aatcaatccctggaccagacccctcagtcgcactcttcagaacagatccaggctatcaag
gaagaagaagaagagaaagggaaaccaagaggcgaggagataccaacccaaaagccagac
cagtga

KEGG   Homo sapiens (human): 5140
Entry
5140              CDS       T01001                                 

Gene name
PDE3B, HcGIP1, cGIPDE1
Definition
(RefSeq) phosphodiesterase 3B
  KO
K13296  cGMP-inhibited 3',5'-cyclic phosphodiesterase B [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04371  Apelin signaling pathway
hsa04910  Insulin signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04922  Glucagon signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Amrinone (DG00228): D00231 D02084
Anagrelide (DG00727): D02933 D07455 D10255<JP/US>
Bemoradan: D03075
Beradilol monoethyl maleate: D09843
Bucladesine (DG00230): D01238<JP> D07546
Caffeine (DG00974): D00528<JP> D01453<JP> D07603<US>
Choline theophyllinate: D02017
Cilostazol: D01896<JP/US>
Diprophylline: D00691<JP>
Enoximone: D04004
Enprofylline: D04006
Ensifentrine: D11743
Flavoxate (DG00477): D00718<JP/US> D07961
Ibudilast: D01385<JP>
Imazodan hydrochloride: D04508
Indolidan: D04529
Isomazole hydrochloride: D04628
Levosimendan: D04720
Lixazinone sulfate: D04751
Milrinone (DG00229): D00417<JP> D02085<US>
Moxaverine (DG00045): D07089 D08238
Olprinone (DG01396): D02042<JP> D08294
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Pimobendan: D01133<JP>
Piroximone: D05514
Prinoxodan: D05612
Proxyphylline: D01771<JP>
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Toborinone: D01198
Trapidil: D01220<JP>
Vesnarinone: D01690
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5140 (PDE3B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    5140 (PDE3B)
   04024 cAMP signaling pathway
    5140 (PDE3B)
   04022 cGMP-PKG signaling pathway
    5140 (PDE3B)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5140 (PDE3B)
   04922 Glucagon signaling pathway
    5140 (PDE3B)
   04923 Regulation of lipolysis in adipocytes
    5140 (PDE3B)
   04914 Progesterone-mediated oocyte maturation
    5140 (PDE3B)
   04924 Renin secretion
    5140 (PDE3B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5140 (PDE3B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     5140 (PDE3B)
SSDB
Motif
Pfam: PDEase_I DUF1129
Other DBs
NCBI-GeneID: 5140
NCBI-ProteinID: NP_000913
OMIM: 602047
HGNC: 8779
Ensembl: ENSG00000152270
Vega: OTTHUMG00000165898
Pharos: Q13370(Tclin)
UniProt: Q13370 A7E2E5
LinkDB
Structure
PDB: 
1SO2 1SOJ

Position
11p15.2
AA seq 1112 aa
MRRDERDAKAMRSLQPPDGAGSPPESLRNGYVKSCVSPLRQDPPRGFFFHLCRFCNVELR
PPPASPQQPRRCSPFCRARLSLGALAAFVLALLLGAEPESWAAGAAWLRTLLSVCSHSLS
PLFSIACAFFFLTCFLTRTKRGPGPGRSCGSWWLLALPACCYLGDFLVWQWWSWPWGDGD
AGSAAPHTPPEAAAGRLLLVLSCVGLLLTLAHPLRLRHCVLVLLLASFVWWVSFTSLGSL
PSALRPLLSGLVGGAGCLLALGLDHFFQIREAPLHPRLSSAAEEKVPVIRPRRRSSCVSL
GETAASYYGSCKIFRRPSLPCISREQMILWDWDLKQWYKPHYQNSGGGNGVDLSVLNEAR
NMVSDLLTDPSLPPQVISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCSEIEDPAEKG
DRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGP
FNSNLLTIPKQRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVSTGSLTNRSPIEFPDT
ADFLNKPSVILQRSLGNAPNTPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSG
KSGEEENIFSKESFKLMETQQEEETEKKDSRKLFQEGDKWLTEEAQSEQQTNIEQEVSLD
LILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVMYTLFQDTGLLEIFKIPTQQF
MNYFRALENGYRDIPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNGCGTGNETDSDGRIN
HGRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQ
AVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFD
FLAEFNAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFY
EQGDEEANLGLPISPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLEAEEDN
DTESGDDEDGEELDTEDEEMENNLNPKPPRRKSRRRIFCQLMHHLTENHKIWKEIVEEEE
KCKADGNKLQVENSSLPQADEIQVIEEADEEE
NT seq 3339 nt   +upstreamnt  +downstreamnt
atgaggagggacgagcgagacgccaaagccatgcggtccctgcagccgccggatggggcc
ggctcgccccccgagagtctgaggaacggctacgtgaagagctgcgtgagccccttgcgg
caggaccctccgcgcggcttcttcttccacctctgccgcttctgcaacgtggagctgcgg
ccgccgccggcctctccccagcagccgcggcgctgctcccccttctgccgggcgcgcctc
tcgctgggcgccctggctgcctttgtcctcgccctgctgctgggcgcggaacccgagagc
tgggctgccggggccgcctggctgcggacgctgctgagcgtgtgttcgcacagcttgagc
cccctcttcagcatcgcctgtgccttcttcttcctcacctgcttcctcacccggaccaag
cggggacccggcccgggccggagctgcggctcctggtggctgctggcgctgcccgcctgc
tgttacctgggggacttcttggtgtggcagtggtggtcttggccttggggggatggcgac
gcagggtccgcggccccgcacacgcccccggaggcggcagcgggcaggttgctgctggtg
ctgagctgcgtagggctgctgctgacgctcgcgcacccgctgcggctccggcactgcgtt
ctggtgctgctcctggccagcttcgtctggtgggtctccttcaccagcctcgggtcgctg
ccctccgccctcaggccgctgctctccggcctggtggggggcgctggctgcctgctggcc
ctggggttggatcacttctttcaaatcagggaagcgcctcttcatcctcgactgtccagt
gccgccgaagaaaaagtgcctgtgatccgaccccggaggaggtccagctgcgtgtcgtta
ggagaaactgcagccagttactatggcagttgcaaaatattcaggagaccgtcgttgcct
tgtatttccagagaacagatgattctttgggattgggacttaaaacaatggtataagcct
cattatcaaaattctggaggtggaaatggagttgatctttcagtgctaaatgaggctcgc
aatatggtgtcagatcttctgactgatccaagccttccaccacaagtcatttcctctcta
cggagtattagtagcttaatgggtgctttctcaggttcctgtaggccaaagattaatcct
ctcacaccatttcctggattttacccctgttctgaaatagaggacccagctgagaaaggg
gatagaaaacttaacaagggactaaataggaatagtttgccaactccacagctgaggaga
agctcaggaacttcaggattgctacctgttgaacagtcttcaaggtgggatcgtaataat
ggcaaaagacctcaccaagaatttggcatttcaagtcaaggatgctatctaaatgggcct
tttaattcaaatctactgactatcccgaagcaaaggtcatcttctgtatcactgactcac
catgtaggtctcagaagagctggtgttttgtccagtctgagtcctgtgaattcttccaac
catggaccagtgtctactggctctctaactaatcgatcacccatagaatttcctgatact
gctgattttcttaataagccaagcgttatcttgcagagatctctgggcaatgcacctaat
actccagatttttatcagcaacttagaaattctgatagcaatctgtgtaacagctgtgga
catcaaatgctgaaatatgtttcaacatctgaatcagatggtacagattgctgcagtgga
aaatcaggtgaagaagaaaacattttctcgaaagaatcattcaaacttatggaaactcaa
caagaagaggaaacagagaagaaagacagcagaaaattatttcaggaaggtgataagtgg
ctaacagaagaggcacagagtgaacagcaaacaaatattgaacaggaagtatcactggac
ctgattttagtagaagagtatgactcattaatagaaaagatgagcaactggaattttcca
atttttgaacttgtagaaaagatgggagagaaatcaggaaggattctcagtcaggttatg
tataccttatttcaagacactggtttattggaaatatttaaaattcccactcaacaattt
atgaactattttcgtgcattagaaaatggctatcgagacattccttatcacaatcgtata
catgccacagatgtgctacatgcagtttggtatctgacaacacggccagttcctggctta
cagcagatccacaatggttgtggaacaggaaatgaaacagattctgatggtagaattaac
catgggcgaattgcttatatttcttcgaagagctgctctaatcctgatgagagttatggc
tgcctgtcttcaaacattcctgcattagaattgatggctctatacgtggcagctgccatg
catgattatgatcacccagggaggacaaatgcatttctagtggctacaaatgcccctcag
gcagttttatacaatgacagatctgttctggaaaatcatcatgctgcgtcagcttggaat
ctatatctttctcgcccagaatacaacttccttcttcatcttgatcatgtggaattcaag
cgctttcgttttttagtcattgaagcaatccttgctacggatcttaaaaagcattttgat
tttctcgcagaattcaatgccaaggcaaatgatgtaaatagtaatggcatagaatggagt
aatgaaaatgatcgcctcttggtatgccaggtgtgcatcaaactggcagatataaatggc
ccagcaaaagttcgagacttgcatttgaaatggacagaaggcattgtcaatgaattttat
gagcagggagatgaagaagcaaatcttggtctgcccatcagtccattcatggatcgttct
tctcctcaactagcaaaactccaagaatcttttatcacccacatagtgggtcccctgtgt
aactcctatgatgctgctggtttgctaccaggtcagtggttagaagcagaagaggataat
gatactgaaagtggtgatgatgaagacggtgaagaattagatacagaagatgaagaaatg
gaaaacaatctaaatccaaaaccaccaagaaggaaaagcagacggcgaatattttgtcag
ctaatgcaccacctcactgaaaaccacaagatatggaaggaaatcgtagaggaagaagaa
aaatgtaaagctgatgggaataaactgcaggtggagaattcctccttacctcaagcagat
gagattcaggtaattgaagaggcagatgaagaggaatag

KEGG   Homo sapiens (human): 5141
Entry
5141              CDS       T01001                                 

Gene name
PDE4A, DPDE2, PDE4, PDE46
Definition
(RefSeq) phosphodiesterase 4A
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04024  cAMP signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Apremilast: D08860<JP/US>
Arofylline: D02985
Bemoradan: D03075
Bucladesine (DG00230): D01238<JP> D07546
Caffeine (DG00974): D00528<JP> D01453<JP> D07603<US>
Choline theophyllinate: D02017
Cilomilast: D01704
Cipamfylline: D03516
Crisaborole: D10873<US>
Difamilast: D11314
Diprophylline: D00691<JP>
Dipyridamole: D00302<JP/US>
Drotaverine (DG00044): D07088 D07879
Enprofylline: D04006
Ensifentrine: D11743
Etazolate hydrochloride: D02655
Filaminast: D04185
Flavoxate (DG00477): D00718<JP/US> D07961
Ibudilast: D01385<JP>
Lotamilast: D11305
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Piclamilast: D05474
Prinoxodan: D05612
Propentofylline: D01630
Proxyphylline: D01771<JP>
Roflumilast: D05744<US>
Rolipram: D01783
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Tofimilast: D09020
Trapidil: D01220<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5141 (PDE4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    5141 (PDE4A)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    5141 (PDE4A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5141 (PDE4A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     5141 (PDE4A)
SSDB
Motif
Pfam: PDEase_I PDE4_UCR
Other DBs
NCBI-GeneID: 5141
NCBI-ProteinID: NP_001104777
OMIM: 600126
HGNC: 8780
Ensembl: ENSG00000065989
Vega: OTTHUMG00000180411
Pharos: P27815(Tclin)
UniProt: P27815
LinkDB
Structure
PDB: 
2QYK 3I8V 3TVX

Position
19p13.2
AA seq 886 aa
MEPPTVPSERSLSLSLPGPREGQATLKPPPQHLWRQPRTPIRIQQRGYSDSAERAERERQ
PHRPIERADAMDTSDRPGLRTTRMSWPSSFHGTGTGSGGAGGGSSRRFEAENGPTPSPGR
SPLDSQASPGLVLHAGAATSQRRESFLYRSDSDYDMSPKTMSRNSSVTSEAHAEDLIVTP
FAQVLASLRSVRSNFSLLTNVPVPSNKRSPLGGPTPVCKATLSEETCQQLARETLEELDW
CLEQLETMQTYRSVSEMASHKFKRMLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVEI
PSPTMKEREKQQAPRPRPSQPPPPPVPHLQPMSQITGLKKLMHSNSLNNSNIPRFGVKTD
QEELLAQELENLNKWGLNIFCVSDYAGGRSLTCIMYMIFQERDLLKKFRIPVDTMVTYML
TLEDHYHADVAYHNSLHAADVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPGV
SNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEDNCDIFQNLSKRQRQSLRKMVIDM
VLATDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPLE
LYRQWTDRIMAEFFQQGDRERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADL
VHPDAQEILDTLEDNRDWYYSAIRQSPSPPPEEESRGPGHPPLPDKFQFELTLEEEEEEE
ISMAQIPCTAQEALTAQGLSGVEEALDATIAWEASPAQESLEVMAQEASLEAELEAVYLT
QQAQSTGSAPVAPDEFSSREEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHAPGLPGLP
STAAEVEAQREHQAAKRACSACAGTFGEDTSALPAPGGGGSGGDPT
NT seq 2661 nt   +upstreamnt  +downstreamnt
atggaacccccgaccgtcccctcggaaaggagcctgtctctgtcactgcccgggccccgg
gagggccaggccaccctgaagcctcccccgcagcacctgtggcggcagcctcggaccccc
atccgtatccagcagcgcggctactccgacagcgcggagcgcgccgagcgggagcggcag
ccgcaccggcccatagagcgcgccgatgccatggacaccagcgaccggcccggcctgcgc
acgacccgcatgtcctggccctcgtccttccatggcactggcaccggcagcggcggcgcg
ggcggaggcagcagcaggcgcttcgaggcagagaatgggccgacaccatctcctggccgc
agccccctggactcgcaggcgagcccaggactcgtgctgcacgccggggcggccaccagc
cagcgccgggagtccttcctgtaccgctcagacagcgactatgacatgtcacccaagacc
atgtcccggaactcatcggtcaccagcgaggcgcacgctgaagacctcatcgtaacacca
tttgctcaggtgctggccagcctccggagcgtccgtagcaacttctcactcctgaccaat
gtgcccgttcccagtaacaagcggtccccgctgggcggccccacccctgtctgcaaggcc
acgctgtcagaagaaacgtgtcagcagttggcccgggagactctggaggagctggactgg
tgtctggagcagctggagaccatgcagacctatcgctctgtcagcgagatggcctcgcac
aagttcaaaaggatgttgaaccgtgagctcacacacctgtcagaaatgagcaggtccgga
aaccaggtctcagagtacatttccacaacattcctggacaaacagaatgaagtggagatc
ccatcacccacgatgaaggaacgagaaaaacagcaagcgccgcgaccaagaccctcccag
ccgcccccgccccctgtaccacacttacagcccatgtcccaaatcacagggttgaaaaag
ttgatgcatagtaacagcctgaacaactctaacattccccgatttggggtgaagaccgat
caagaagagctcctggcccaagaactggagaacctgaacaagtggggcctgaacatcttt
tgcgtgtcggattacgctggaggccgctcactcacctgcatcatgtacatgatattccag
gagcgggacctgctgaagaaattccgcatccctgtggacacgatggtgacatacatgctg
acgctggaggatcactaccacgctgacgtggcctaccataacagcctgcacgcagctgac
gtgctgcagtccacccacgtactgctggccacgcctgcactagatgcagtgttcacggac
ctggagattctcgccgccctcttcgcggctgccatccacgatgtggatcaccctggggtc
tccaaccagttcctcatcaacaccaattcggagctggcgctcatgtacaacgatgagtcg
gtgctcgagaatcaccacctggccgtgggcttcaagctgctgcaggaggacaactgcgac
atcttccagaacctcagcaagcgccagcggcagagcctacgcaagatggtcatcgacatg
gtgctggccacggacatgtccaagcacatgaccctcctggctgacctgaagaccatggtg
gagaccaagaaagtgaccagctcaggggtcctcctgctagataactactccgaccgcatc
caggtcctccggaacatggtgcactgtgccgacctcagcaaccccaccaagccgctggag
ctgtaccgccagtggacagaccgcatcatggccgagttcttccagcagggtgaccgagag
cgcgagcgtggcatggaaatcagccccatgtgtgacaagcacactgcctccgtggagaag
tctcaggtgggttttattgactacattgtgcacccattgtgggagacctgggcggacctt
gtccacccagatgcccaggagatcttggacactttggaggacaaccgggactggtactac
agcgccatccggcagagcccatctccgccacccgaggaggagtcaagggggccaggccac
ccacccctgcctgacaagttccagtttgagctgacgctggaggaggaagaggaggaagaa
atatcaatggcccagataccgtgcacagcccaagaggcattgactgcgcagggattgtca
ggagtcgaggaagctctggatgcaaccatagcctgggaggcatccccggcccaggagtcg
ttggaagttatggcacaggaagcatccctggaggccgagctggaggcagtgtatttgaca
cagcaggcacagtccacaggcagtgcacctgtggctccggatgagttctcgtcccgggag
gaattcgtggttgctgtaagccacagcagcccctctgccctggctcttcaaagccccctt
ctccctgcttggaggaccctgtctgtttcagagcatgccccgggcctcccgggcctcccc
tccacggcggccgaggtggaggcccaacgagagcaccaggctgccaagagggcttgcagt
gcctgcgcagggacatttggggaggacacatccgcactcccagctcctggtggcgggggg
tcaggtggagaccctacctga

KEGG   Homo sapiens (human): 5142
Entry
5142              CDS       T01001                                 

Gene name
PDE4B, DPDE4, PDEIVB
Definition
(RefSeq) phosphodiesterase 4B
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04024  cAMP signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Apremilast: D08860<JP/US>
Arofylline: D02985
Bemoradan: D03075
Bucladesine (DG00230): D01238<JP> D07546
Caffeine (DG00974): D00528<JP> D01453<JP> D07603<US>
Choline theophyllinate: D02017
Cilomilast: D01704
Cipamfylline: D03516
Crisaborole: D10873<US>
Difamilast: D11314
Diprophylline: D00691<JP>
Drotaverine (DG00044): D07088 D07879
Enprofylline: D04006
Ensifentrine: D11743
Etazolate hydrochloride: D02655
Filaminast: D04185
Flavoxate (DG00477): D00718<JP/US> D07961
Ibudilast: D01385<JP>
Lotamilast: D11305
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Piclamilast: D05474
Prinoxodan: D05612
Propentofylline: D01630
Proxyphylline: D01771<JP>
Roflumilast: D05744<US>
Rolipram: D01783
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Tofimilast: D09020
Trapidil: D01220<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5142 (PDE4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    5142 (PDE4B)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    5142 (PDE4B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5142 (PDE4B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     5142 (PDE4B)
SSDB
Motif
Pfam: PDEase_I PDE4_UCR PFam54_60
Other DBs
NCBI-GeneID: 5142
NCBI-ProteinID: NP_001032418
OMIM: 600127
HGNC: 8781
Ensembl: ENSG00000184588
Vega: OTTHUMG00000009088
Pharos: Q07343(Tclin)
UniProt: Q07343 X5DNX5
LinkDB
Structure
PDB: 

Position
1p31.3
AA seq 736 aa
MKKSRSVMTVMADDNVKDYFECSLSKSYSSSSNTLGIDLWRGRRCCSGNLQLPPLSQRQS
ERARTPEGDGISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSAGLVL
HATFPGHSQRRESFLYRSDSDYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRSVR
NNFTILTNLHGTSNKRSPAASQPPVSRVNPQEESYQKLAMETLEELDWCLDQLETIQTYR
SVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKK
KQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSH
NRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHV
LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHL
AVGFKLLQEEHCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTS
SGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEI
SPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQSP
SPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLG
ETDIDIATEDKSPVDT
NT seq 2211 nt   +upstreamnt  +downstreamnt
atgaagaaaagcaggagtgtgatgacggtgatggctgatgataatgttaaagattatttt
gaatgtagcttgagtaaatcctacagttcttccagtaacacacttgggatcgacctctgg
agagggagaaggtgttgctcaggaaacttacagttaccaccactgtctcaaagacagagt
gaaagggcaaggactcctgagggagatggtatttccaggccgaccacactgcctttgaca
acgcttccaagcattgctattacaactgtaagccaggagtgctttgatgtggaaaatggc
ccttccccaggtcggagtccactggatccccaggccagctcttccgctgggctggtactt
cacgccacctttcctgggcacagccagcgcagagagtcatttctctacagatcagacagc
gactatgacttgtcaccaaaggcgatgtcgagaaactcttctcttccaagcgagcaacac
ggcgatgacttgattgtaactccttttgcccaggtccttgccagcttgcgaagtgtgaga
aacaacttcactatactgacaaaccttcatggtacatctaacaagaggtccccagctgct
agtcagcctcctgtctccagagtcaacccacaagaagaatcttatcaaaaattagcaatg
gaaacgctggaggaattagactggtgtttagaccagctagagaccatacagacctaccgg
tctgtcagtgagatggcttctaacaagttcaaaagaatgctgaaccgggagctgacacac
ctctcagagatgagccgatcagggaaccaggtgtctgaatacatttcaaatactttctta
gacaagcagaatgatgtggagatcccatctcctacccagaaagacagggagaaaaagaaa
aagcagcagctcatgacccagataagtggagtgaagaaattaatgcatagttcaagccta
aacaatacaagcatctcacgctttggagtcaacactgaaaatgaagatcacctggccaag
gagctggaagacctgaacaaatggggtcttaacatctttaatgtggctggatattctcac
aatagacccctaacatgcatcatgtatgctatattccaggaaagagacctcctaaagaca
ttcagaatctcatctgacacatttataacctacatgatgactttagaagaccattaccat
tctgacgtggcatatcacaacagcctgcacgctgctgatgtagcccagtcgacccatgtt
ctcctttctacaccagcattagacgctgtcttcacagatttggagatcctggctgccatt
tttgcagctgccatccatgacgttgatcatcctggagtctccaatcagtttctcatcaac
acaaattcagaacttgctttgatgtataatgatgaatctgtgttggaaaatcatcacctt
gctgtgggtttcaaactgctgcaagaagaacactgtgacatcttcatgaatctcaccaag
aagcagcgtcagacactcaggaagatggttattgacatggtgttagcaactgatatgtct
aaacatatgagcctgctggcagacctgaagacaatggtagaaacgaagaaagttacaagt
tcaggcgttcttctcctagacaactataccgatcgcattcaggtccttcgcaacatggta
cactgtgcagacctgagcaaccccaccaagtccttggaattgtatcggcaatggacagac
cgcatcatggaggaatttttccagcagggagacaaagagcgggagaggggaatggaaatt
agcccaatgtgtgataaacacacagcttctgtggaaaaatcccaggttggtttcatcgac
tacattgtccatccattgtgggagacatgggcagatttggtacagcctgatgctcaggac
attctcgataccttagaagataacaggaactggtatcagagcatgatacctcaaagtccc
tcaccaccactggacgagcagaacagggactgccagggtctgatggagaagtttcagttt
gaactgactctcgatgaggaagattctgaaggacctgagaaggagggagagggacacagc
tatttcagcagcacaaagacgctttgtgtgattgatccagaaaacagagattccctggga
gagactgacatagacattgcaacagaagacaagtcccccgtggatacataa

KEGG   Homo sapiens (human): 5143
Entry
5143              CDS       T01001                                 

Gene name
PDE4C, DPDE1, PDE21
Definition
(RefSeq) phosphodiesterase 4C
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04024  cAMP signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Apremilast: D08860<JP/US>
Arofylline: D02985
Bemoradan: D03075
Bucladesine (DG00230): D01238<JP> D07546
Caffeine (DG00974): D00528<JP> D01453<JP> D07603<US>
Choline theophyllinate: D02017
Cilomilast: D01704
Cipamfylline: D03516
Crisaborole: D10873<US>
Difamilast: D11314
Diprophylline: D00691<JP>
Drotaverine (DG00044): D07088 D07879
Enprofylline: D04006
Ensifentrine: D11743
Etazolate hydrochloride: D02655
Filaminast: D04185
Flavoxate (DG00477): D00718<JP/US> D07961
Ibudilast: D01385<JP>
Lotamilast: D11305
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Piclamilast: D05474
Prinoxodan: D05612
Propentofylline: D01630
Proxyphylline: D01771<JP>
Roflumilast: D05744<US>
Rolipram: D01783
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Tofimilast: D09020
Trapidil: D01220<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5143 (PDE4C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    5143 (PDE4C)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    5143 (PDE4C)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5143 (PDE4C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     5143 (PDE4C)
SSDB
Motif
Pfam: PDEase_I PDE4_UCR
Other DBs
NCBI-GeneID: 5143
NCBI-ProteinID: NP_000914
OMIM: 600128
HGNC: 8782
Ensembl: ENSG00000105650
Vega: OTTHUMG00000183353
Pharos: Q08493(Tclin)
UniProt: Q08493 Q32MM7 O43849
LinkDB
Structure
PDB: 
2QYM

Position
19p13.11
AA seq 712 aa
MENLGVGEGAEACSRLSRSRGRHSMTRAPKHLWRQPRRPIRIQQRFYSDPDKSAGCRERD
LSPRPELRKSRLSWPVSSCRRFDLENGLSCGRRALDPQSSPGLGRIMQAPVPHSQRRESF
LYRSDSDYELSPKAMSRNSSVASDLHGEDMIVTPFAQVLASLRTVRSNVAALARQQCLGA
AKQGPVGNPSSSNQLPPAEDTGQKLALETLDELDWCLDQLETLQTRHSVGEMASNKFKRI
LNRELTHLSETSRSGNQVSEYISRTFLDQQTEVELPKVTAEEAPQPMSRISGLHGLCHSA
SLSSATVPRFGVQTDQEEQLAKELEDTNKWGLDVFKVAELSGNRPLTAIIFSIFQERDLL
KTFQIPADTLATYLLMLEGHYHANVAYHNSLHAADVAQSTHVLLATPALEAVFTDLEILA
ALFASAIHDVDHPGVSNQFLINTNSELALMYNDASVLENHHLAVGFKLLQAENCDIFQNL
SAKQRLSLRRMVIDMVLATDMSKHMNLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQN
LVHCADLSNPTKPLPLYRQWTDRIMAEFFQQGDRERESGLDISPMCDKHTASVEKSQVGF
IDYIAHPLWETWADLVHPDAQDLLDTLEDNREWYQSKIPRSPSDLTNPERDGPDRFQFEL
TLEEAEEEDEEEEEEGEETALAKEALELPDTELLSPEAGPDPGDLPLDNQRT
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggagaacctgggggtcggcgaaggggcagaggcttgcagcaggttgagtcgctctcgc
ggccgccacagcatgaccagagccccgaagcacctgtggcggcaaccccggcgccccatc
cgcatccaacagcgcttctattcggatccggacaagtccgcgggctgccgcgagagggac
ctgagcccgcggccggagctcaggaagtcgcggctctcctggcccgtttcctcctgcagg
cgctttgacctggaaaatgggctctcgtgtgggaggagggccctggaccctcagtccagc
cctggcctgggccggattatgcaggctccagtcccgcacagccagcggcgcgagtccttc
ctgtaccgctcagatagcgactatgaactctcgcccaaggccatgtctcggaactcctct
gtggccagcgacctacatggagaggacatgattgtgacgccctttgcccaggtcctggcc
agtctgcggaccgttcggagcaacgtggcggcccttgcccgccagcaatgcctaggagca
gccaagcagggacccgtcggaaacccttcatccagcaatcagctccctcctgcagaggac
acggggcagaagctggcattggagacgctagacgagctggactggtgcctggatcagttg
gagacgctgcagacccggcactcggtgggggagatggcctccaacaagttcaagcggatc
ctgaaccgggagttgacccacctgtccgaaaccagccgctccgggaaccaggtgtccgag
tacatctcccggaccttcctggaccagcagaccgaggtggagctgcccaaggtgaccgct
gaggaggccccacagcccatgtcccggatcagtggcctacatgggctctgccacagtgcc
agcctctcctcagccactgtcccacgctttggggtccagactgaccaggaggagcaactg
gccaaggagctagaagacaccaacaagtggggacttgatgtgttcaaggtggcggagcta
agtgggaaccggcccctcacagctatcatattcagcatttttcaggagcgggacctgctg
aagacattccagatcccagcagacacactggccacctacctgctgatgctggaaggtcac
taccacgccaatgtggcctaccacaacagcctacatgccgccgacgtggcccagtccacg
catgtgctgctggctacgcccgccctcgaggctgtgttcacagacttggaaatcctggct
gccctctttgcaagcgccatccacgacgtggaccatcctggggtctccaaccagtttctg
attaacaccaactcagagctggcgcttatgtacaacgacgcctcggtgctggagaaccat
cacctggctgtgggcttcaagctgctgcaggcagagaactgcgatatcttccagaacctc
agcgccaagcagcgactgagtctgcgcaggatggtcattgacatggtgctggccacagac
atgtccaaacacatgaacctcctggccgacctcaagaccatggtggagaccaagaaggtg
acaagcctcggtgtcctcctcctggacaactattccgaccgaatccaggtcttgcagaac
ctggtgcactgtgctgatctgagcaaccccaccaagccgctgcccctgtaccgccagtgg
acggaccgcatcatggccgagttcttccagcagggagaccgcgagcgtgagtcgggcctg
gacatcagtcccatgtgtgacaagcatacggcctcagtggagaagtcccaggtgggtttc
attgactacattgctcacccactgtgggagacttgggctgacctggtccacccagatgca
caggacctgctggacacgctggaggacaatcgagagtggtaccagagcaagatcccccga
agtccctcagacctcaccaaccccgagcgggacgggcctgacagattccagtttgaactg
actctggaggaggcagaggaagaggatgaggaggaagaagaggagggggaagagacagct
ttagccaaagaggccttggagttgcctgacactgaactcctgtcccctgaagccggccca
gaccctggggacttacccctcgacaaccagaggacttag

KEGG   Homo sapiens (human): 5144
Entry
5144              CDS       T01001                                 

Gene name
PDE4D, ACRDYS2, DPDE3, HSPDE4D, PDE43, PDE4DN2, STRK1
Definition
(RefSeq) phosphodiesterase 4D
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04024  cAMP signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05032  Morphine addiction
Disease
H02211  Acrodysostosis
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Apremilast: D08860<JP/US>
Arofylline: D02985
Bemoradan: D03075
Bucladesine (DG00230): D01238<JP> D07546
Caffeine (DG00974): D00528<JP> D01453<JP> D07603<US>
Choline theophyllinate: D02017
Cilomilast: D01704
Cipamfylline: D03516
Crisaborole: D10873<US>
Difamilast: D11314
Diprophylline: D00691<JP>
Drotaverine (DG00044): D07088 D07879
Enprofylline: D04006
Ensifentrine: D11743
Etazolate hydrochloride: D02655
Filaminast: D04185
Flavoxate (DG00477): D00718<JP/US> D07961
Ibudilast: D01385<JP>
Lotamilast: D11305
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Piclamilast: D05474
Prinoxodan: D05612
Propentofylline: D01630
Proxyphylline: D01771<JP>
Roflumilast: D05744<US>
Rolipram: D01783
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Tofimilast: D09020
Trapidil: D01220<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5144 (PDE4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    5144 (PDE4D)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    5144 (PDE4D)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5144 (PDE4D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     5144 (PDE4D)
SSDB
Motif
Pfam: PDEase_I PDE4_UCR
Other DBs
NCBI-GeneID: 5144
NCBI-ProteinID: NP_001098101
OMIM: 600129
HGNC: 8783
Ensembl: ENSG00000113448
Vega: OTTHUMG00000162218
Pharos: Q08499(Tclin)
UniProt: Q08499 A0A140VJR0
LinkDB
Structure
PDB: 

Position
5q11.2-q12.1
AA seq 809 aa
MEAEGSSAPARAGSGEGSDSAGGATLKAPKHLWRHEQHHQYPLRQPQFRLLHPHHHLPPP
PPPSPQPQPQCPLQPPPPPPLPPPPPPPGAARGRYASSGATGRVRHRGYSDTERYLYCRA
MDRTSYAVETGHRPGLKKSRMSWPSSFQGLRRFDVDNGTSAGRSPLDPMTSPGSGLILQA
NFVHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVTPFAQVLASLRTVRNNF
AALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASETLEELDWCLDQLETLQTRHSV
SEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTFLDKQHEVEIPSPTQKEKEKKKRP
MSQISGVKKLMHSSSLTNSSIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPL
TVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLST
PALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGF
KLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVL
LLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMC
DKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAP
DDPEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPL
DEQVEEEAVGEEEESQPEACVIDDRSPDT
NT seq 2430 nt   +upstreamnt  +downstreamnt
atggaggcagagggcagcagcgcgccggcccgggcgggcagcggagagggcagcgacagc
gccggcggggccacgctcaaagcccccaagcatctctggaggcacgagcagcaccaccag
tacccgctccggcagccccagttccgcctcctgcatccccatcaccacctgcccccgccg
ccgccaccctcgccccagccccagccccagtgtccgctacagccgccgccgccgcccccc
ctgccgccgcccccgccgccgcccggggctgcccgcggccgctacgcctcgagcggggcc
accggccgcgtccggcatcgcggctactcggacaccgagcgctacctgtactgtcgcgcc
atggaccgcacctcctacgcggtggagaccggccaccggcccggcctgaagaaatccagg
atgtcctggccctcctcgttccagggactcaggcgttttgatgtggacaatggcacatct
gcgggacggagtcccttggatcccatgaccagcccaggatccgggctaattctccaagca
aattttgtccacagtcaacgacgggagtccttcctgtatcgatccgacagcgattatgac
ctctctccaaagtctatgtcccggaactcctccattgccagtgatatacacggagatgac
ttgattgtgactccatttgctcaggtcttggccagtctgcgaactgtacgaaacaacttt
gctgcattaactaatttgcaagatcgagcacctagcaaaagatcacccatgtgcaaccaa
ccatccatcaacaaagccaccataacagaggaggcctaccagaaactggccagcgagacc
ctggaggagctggactggtgtctggaccagctagagaccctacagaccaggcactccgtc
agtgagatggcctccaacaagtttaaaaggatgcttaatcgggagctcacccatctctct
gaaatgagtcggtctggaaatcaagtgtcagagtttatatcaaacacattcttagataag
caacatgaagtggaaattccttctccaactcagaaggaaaaggagaaaaagaaaagacca
atgtctcagatcagtggagtcaagaaattgatgcacagctctagtctgactaattcaagt
atcccaaggtttggagttaaaactgaacaagaagatgtccttgccaaggaactagaagat
gtgaacaaatggggtcttcatgttttcagaatagcagagttgtctggtaaccggcccttg
actgttatcatgcacaccatttttcaggaacgggatttattaaaaacatttaaaattcca
gtagatactttaattacatatcttatgactctcgaagaccattaccatgctgatgtggcc
tatcacaacaatatccatgctgcagatgttgtccagtctactcatgtgctattatctaca
cctgctttggaggctgtgtttacagatttggagattcttgcagcaatttttgccagtgca
atacatgatgtagatcatcctggtgtgtccaatcaatttctgatcaatacaaactctgaa
cttgccttgatgtacaatgattcctcagtcttagagaaccatcatttggctgtgggcttt
aaattgcttcaggaagaaaactgtgacattttccagaatttgaccaaaaaacaaagacaa
tctttaaggaaaatggtcattgacatcgtacttgcaacagatatgtcaaaacacatgaat
ctactggctgatttgaagactatggttgaaactaagaaagtgacaagctctggagttctt
cttcttgataattattccgataggattcaggttcttcagaatatggtgcactgtgcagat
ctgagcaacccaacaaagcctctccagctgtaccgccagtggacggaccggataatggag
gagttcttccgccaaggagaccgagagagggaacgtggcatggagataagccccatgtgt
gacaagcacaatgcttccgtggaaaaatcacaggtgggcttcatagactatattgttcat
cccctctgggagacatgggcagacctcgtccaccctgacgcccaggatattttggacact
ttggaggacaatcgtgaatggtaccagagcacaatccctcagagcccctctcctgcacct
gatgacccagaggagggccggcagggtcaaactgagaaattccagtttgaactaacttta
gaggaagatggtgagtcagacacggaaaaggacagtggcagtcaagtggaagaagacact
agctgcagtgactccaagactctttgtactcaagactcagagtctactgaaattcccctt
gatgaacaggttgaagaggaggcagtaggggaagaagaggaaagccagcctgaagcctgt
gtcatagatgatcgttctcctgacacgtaa

KEGG   Homo sapiens (human): 5150
Entry
5150              CDS       T01001                                 

Gene name
PDE7A, HCP1, PDE7
Definition
(RefSeq) phosphodiesterase 7A
  KO
K18436  high affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Bemoradan: D03075
Bucladesine (DG00230): D01238<JP> D07546
Choline theophyllinate: D02017
Diprophylline: D00691<JP>
Enprofylline: D04006
Flavoxate (DG00477): D00718<JP/US> D07961
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Prinoxodan: D05612
Proxyphylline: D01771<JP>
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5150 (PDE7A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5150 (PDE7A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     5150 (PDE7A)
SSDB
Motif
Pfam: PDEase_I
Other DBs
NCBI-GeneID: 5150
NCBI-ProteinID: NP_001229247
OMIM: 171885
HGNC: 8791
Ensembl: ENSG00000205268
Vega: OTTHUMG00000164469
Pharos: Q13946(Tclin)
UniProt: Q13946
LinkDB
Structure
PDB: 
1ZKL 4PM0 4Y2B 3G3N

Position
8q13.1
AA seq 482 aa
MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPNPRQLSQRRGAISYDSSDQTA
LYIRMLGDVRVRSRAGFESERRGSHPYIDFRIFHSQSEIEVSVSARNIRRLLSFQRYLRS
SRFFRGTAVSNSLNILDDDYNGQAKCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSL
HGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLANSVTPW
DILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFS
HLPLESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLCLEDTRHRHLVLQMALKC
ADICNPCRTWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQIGFMTYL
VEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGLQREQSSSEDTDAAFELNSQLLPQENR
LS
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggaagtgtgttaccagctgccggtactgcccctggacaggccggtcccccagcacgtc
ctcagccgccgaggagccatcagcttcagctccagctccgctctcttcggctgccccaat
ccccggcagctctctcagaggcgtggagctatttcctatgacagttctgatcagactgca
ttatacattcgtatgctaggagatgtacgtgtaaggagccgagcaggatttgaatcagaa
agaagaggttctcacccatatattgattttcgtattttccactctcaatctgaaattgaa
gtgtctgtctctgcaaggaatatcagaaggctactaagtttccagcgatatcttagatct
tcacgcttttttcgtggtactgcggtttcaaattccctaaacattttagatgatgattat
aatggacaagccaagtgtatgctggaaaaagttggaaattggaattttgatatctttcta
tttgatagactaacaaatggaaatagtctagtaagcttaacctttcatttatttagtctt
catggattaattgagtacttccatttagatatgatgaaacttcgtagatttttagttatg
attcaagaagattaccacagtcaaaatccttaccataacgcagtccacgctgcggatgtt
actcaggccatgcactgttacttaaaggaacctaagcttgccaattctgtaactccttgg
gatatcttgctgagcttaattgcagctgccactcatgatctggatcatccaggtgttaat
caacctttccttattaaaactaaccattacttggcaactttatacaagaatacctcagta
ctggaaaatcaccactggagatctgcagtgggcttattgagagaatcaggcttattctca
catctgccattagaaagcaggcaacaaatggagacacagataggtgctctgatactagcc
acagacatcagtcgccagaatgagtatctgtctttgtttaggtcccatttggatagaggt
gatttatgcctagaagacaccagacacagacatttggttttacagatggctttgaaatgt
gctgatatttgtaacccatgtcggacgtgggaattaagcaagcagtggagtgaaaaagta
acggaggaattcttccatcaaggagatatagaaaaaaaatatcatttgggtgtgagtcca
ctttgcgatcgtcacactgaatctattgccaacatccagattggttttatgacttaccta
gtggagcctttatttacagaatgggccaggttttccaatacaaggctatcccagacaatg
cttggacacgtggggctgaataaagccagctggaagggactgcagagagaacagtcgagc
agtgaggacactgatgctgcatttgagttgaactcacagttattacctcaggaaaatcgg
ttatcataa

KEGG   Homo sapiens (human): 5151
Entry
5151              CDS       T01001                                 

Gene name
PDE8A, HsT19550
Definition
(RefSeq) phosphodiesterase 8A
  KO
K18437  high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04927  Cortisol synthesis and secretion
hsa04934  Cushing syndrome
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Bemoradan: D03075
Bucladesine (DG00230): D01238<JP> D07546
Choline theophyllinate: D02017
Diprophylline: D00691<JP>
Enprofylline: D04006
Flavoxate (DG00477): D00718<JP/US> D07961
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Prinoxodan: D05612
Proxyphylline: D01771<JP>
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5151 (PDE8A)
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    5151 (PDE8A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5151 (PDE8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    5151 (PDE8A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     5151 (PDE8A)
SSDB
Motif
Pfam: PDEase_I PAS PAS_9 PAS_4 PAS_3 PDE8 PAS_8 HTH_23
Other DBs
NCBI-GeneID: 5151
NCBI-ProteinID: NP_002596
OMIM: 602972
HGNC: 8793
Ensembl: ENSG00000073417
Vega: OTTHUMG00000148670
Pharos: O60658(Tclin)
UniProt: O60658
LinkDB
Structure
PDB: 
3ECM 3ECN

Position
15q25.3
AA seq 829 aa
MGCAPSIHISERLVAEDAPSPAAPPLSSGGPRLPQGQKTAALPRTRGAGLLESELRDGSG
KKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACF
LDKHHDIIIIDHRNPRQLDAEALCRSIRSSKLSENTVIVGVVRRVDREELSVMPFISAGF
TRRYVENPNIMACYNELLQLEFGEVRSQLKLRACNSVFTALENSEDAIEITSEDRFIQYA
NPAFETTMGYQSGELIGKELGEVPINEKKADLLDTINSCIRIGKEWQGIYYAKKKNGDNI
QQNVKIIPVIGQGGKIRHYVSIIRVCNGNNKAEKISECVQSDTHTDNQTGKHKDRRKGSL
DVKAVASRATEVSSQRRHSSMARIHSMTIEAPITKVINIINAAQESSPMPVTEALDRVLE
ILRTTELYSPQFGAKDDDPHANDLVGGLMSDGLRRLSGNEYVLSTKNTQMVSSNIITPIS
LDDVPPRIARAMENEEYWDFDIFELEAATHNRPLIYLGLKMFARFGICEFLHCSESTLRS
WLQIIEANYHSSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDH
PGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTGDDKCNIFKNMERNDYRTLRQG
IIDMVLATEMTKHFEHVNKFVNSINKPLATLEENGETDKNQEVINTMLRTPENRTLIKRM
LIKCADVSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRNTCSIPKSQIS
FIDYFITDMFDAWDAFVDLPDLMQHLDNNFKYWKGLDEMKLRNLRPPPE
NT seq 2490 nt   +upstreamnt  +downstreamnt
atgggctgtgccccgagcatccacatttccgagcgcctggtggccgaggacgcgcctagc
cccgcggcaccgccgctgtcgtccggcgggccgcgcctcccgcagggccagaagacggcc
gccttgccccggacccgcggcgccggcctcttggagtcggagcttcgcgacggcagcggc
aagaaggtagcagtagctgatgtgcagtttggccccatgagatttcatcaagatcaactt
caggtacttttagtgtttaccaaagaagataaccaatgtaatggattctgcagggcatgt
gaaaaagcagggtttaagtgtacagttaccaaggaggctcaggctgtccttgcctgtttc
ctggacaaacatcatgacattatcatcatagaccacagaaatcctcgacagctggatgca
gaggcactgtgcaggtctatcagatcatcaaaactctcagaaaacacagttattgttggt
gtagtacgcagggtggatagagaagagttgtccgtaatgcctttcatttctgctggattt
acaaggaggtatgtagaaaaccccaacatcatggcctgctacaatgaactgctccagctg
gagtttggagaggtgcgatcacaactgaaactcagggcttgtaactcagtattcactgca
ttagaaaacagtgaagatgcaattgaaattacaagcgaagaccgttttatacagtatgca
aatcctgcatttgaaacaacaatgggctatcagtcaggtgaattaatagggaaggagtta
ggagaagtgcctataaatgaaaaaaaggctgacttgctcgatactataaattcatgcatc
aggataggcaaggagtggcaaggaatttactatgccaaaaagaaaaacggagataatata
caacaaaatgtgaagataatacctgtcattggacagggaggaaaaattagacactatgtg
tccattatcagagtgtgcaatggcaacaataaggctgagaaaatatccgaatgtgttcag
tctgacactcatacagataatcagacaggcaaacataaagacaggagaaaaggctcacta
gacgtcaaagctgttgcctcccgtgcaactgaagtttccagccagagacgacactcttcc
atggcccggatacattccatgacaattgaggcgcccatcaccaaggtaatcaatattatc
aatgctgcccaggaaagtagtcccatgcctgtgacagaagccctagaccgtgtgctggaa
attctaagaaccactgagttatattcaccacagtttggtgctaaagatgatgatccccat
gccaatgaccttgttgggggcttaatgtctgatggtttgcgaagactatcagggaatgaa
tatgttctttcaacaaaaaacactcaaatggtttcaagcaatataatcactcccatctcc
cttgatgatgtcccaccacggatagctcgggccatggaaaatgaggaatactgggacttt
gatatttttgaactggaggctgccacccacaataggcctttgatttatcttggtctcaaa
atgtttgctcgctttggaatctgtgaattcttacactgctccgagtcaacgctaagatca
tggttacaaattatcgaagccaattatcattcctccaatccctaccacaattctacacat
tctgctgatgtgcttcatgccactgcctattttctctccaaggagaggataaaggaaact
ttagatccaattgatgaggtcgctgcactcatcgcagccaccattcatgatgtggatcac
cctgggagaaccaactccttcctgtgtaatgctggaagtgagctggccattttgtacaat
gacactgctgtgctggagagccaccatgcggccttggccttccagctgaccactggagat
gataaatgcaatatatttaaaaacatggagaggaatgattatcggacactgcgccagggg
attatcgacatggtcttagccacagaaatgacaaagcactttgagcatgtcaacaaattt
gtcaacagcatcaacaaacccttggcaacactagaagaaaatggggaaactgataaaaac
caggaagtgataaacactatgcttaggactccagagaaccggaccctaatcaaacgaatg
ctgattaaatgtgctgatgtgtccaatccctgccgacccctgcagtactgcatcgagtgg
gctgcacgcatttcggaagaatatttttctcagactgatgaagagaagcagcagggctta
cctgtggtgatgccagtgtttgacagaaatacctgcagcatccccaaatcccaaatctct
ttcattgattacttcatcacagacatgtttgatgcttgggatgcctttgtagacctgcct
gatttaatgcagcatcttgacaacaactttaaatactggaaaggactggacgaaatgaag
ctgcggaacctccgaccacctcctgaatag

KEGG   Homo sapiens (human): 5153
Entry
5153              CDS       T01001                                 

Gene name
PDE1B, HEL-S-79p, PDE1B1, PDES1B
Definition
(RefSeq) phosphodiesterase 1B
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04740  Olfactory transduction
hsa04742  Taste transduction
hsa04924  Renin secretion
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Bemoradan: D03075
Bucladesine (DG00230): D01238<JP> D07546
Caffeine (DG00974): D00528<JP> D01453<JP> D07603<US>
Choline theophyllinate: D02017
Diprophylline: D00691<JP>
Enprofylline: D04006
Flavoxate (DG00477): D00718<JP/US> D07961
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Prinoxodan: D05612
Proxyphylline: D01771<JP>
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5153 (PDE1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    5153 (PDE1B)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    5153 (PDE1B)
  09157 Sensory system
   04740 Olfactory transduction
    5153 (PDE1B)
   04742 Taste transduction
    5153 (PDE1B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5153 (PDE1B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     5153 (PDE1B)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N La_HTH_kDCL
Other DBs
NCBI-GeneID: 5153
NCBI-ProteinID: NP_000915
OMIM: 171891
HGNC: 8775
Ensembl: ENSG00000123360
Vega: OTTHUMG00000169844
Pharos: Q01064(Tclin)
UniProt: Q01064 A0A024RB59
LinkDB
Structure
PDB: 

Position
12q13.2
AA seq 536 aa
MELSPRSPPEMLEESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEINIEELKKNL
EYTASLLEAVYIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQARAKGRRAEEKP
KFRSIVHAVQAGIFVERMFRRTYTSVGPTYSTAVLNCLKNLDLWCFDVFSLNQAADDHAL
RTIVFELLTRHNLISRFKIPTVFLMSFLDALETGYGKYKNPYHNQIHAADVTQTVHCFLL
RTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKSECAIVYNDRSVLENHHISSV
FRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTALQQLERIDKPK
ALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQS
QIGFIDFIVEPTFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVS
FRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggagctgtccccccgcagtcctccggagatgctggaggagtcggattgcccgtcaccc
ctggagctgaagtcagcccccagcaagaagatgtggattaagcttcggtctctgctgcgc
tacatggtgaagcagttggagaatggggagataaacattgaggagctgaagaaaaatctg
gagtacacagcttctctgctggaagccgtctacatagatgagacacggcaaatcttggac
acggaggacgagctgcaggagctgcggtcagatgccgtgccttcggaggtgcgggactgg
ctggcctccaccttcacccagcaggcccgggccaaaggccgccgagcagaggagaagccc
aagttccgaagcattgtgcacgctgtgcaggctgggatcttcgtggaacggatgttccgg
agaacatacacctctgtgggccccacttactctactgcggttctcaactgtctcaagaac
ctggatctctggtgctttgatgtcttttccttgaaccaggcagcagatgaccatgccctg
aggaccattgtttttgagttgctgactcggcataacctcatcagccgcttcaagattccc
actgtgtttttgatgagtttcctggatgccttggagacaggctatgggaagtacaagaat
ccttaccacaaccagatccacgcagccgatgttacccagacagtccattgcttcttgctc
cgcacagggatggtgcactgcctgtcggagattgagctcctggccatcatctttgctgca
gctatccatgattatgagcacacgggcactaccaacagcttccacatccagaccaagtca
gaatgtgccatcgtgtacaatgatcgttcagtgctggagaatcaccacatcagctctgtt
ttccgattgatgcaggatgatgagatgaacattttcatcaacctcaccaaggatgagttt
gtagaactccgagccctggtcattgagatggtgttggccacagacatgtcctgccatttc
cagcaagtgaagaccatgaagacagccttgcaacagctggagaggattgacaagcccaag
gccctgtctctactgctccatgctgctgacatcagccacccaaccaagcagtggttggtc
cacagccgttggaccaaggccctcatggaggaattcttccgtcagggtgacaaggaggca
gagttgggcctgcccttttctccactctgtgaccgcacttccactctagtggcacagtct
cagatagggttcatcgacttcattgtggagcccacattctctgtgctgactgacgtggca
gagaagagtgttcagcccctggcggatgaggactccaagtctaaaaaccagcccagcttt
cagtggcgccagccctctctggatgtggaagtgggagaccccaaccctgatgtggtcagc
tttcgttccacctgggtcaagcgcattcaggagaataagcagaaatggaaggaacgggca
gcaagtggcatcaccaaccagatgtccattgacgagctgtccccctgtgaagaagaggcc
cccccatcccctgccgaagatgaacacaaccagaatgggaatctggattag

KEGG   Homo sapiens (human): 8622
Entry
8622              CDS       T01001                                 

Gene name
PDE8B, ADSD, PPNAD3
Definition
(RefSeq) phosphodiesterase 8B
  KO
K18437  high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04927  Cortisol synthesis and secretion
hsa04934  Cushing syndrome
hsa05032  Morphine addiction
Network
nt06310  CRH-ACTH-cortisol signaling
nt06360  Cushing syndrome
  Element
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
Disease
H00260  Pigmented micronodular adrenocortical disease
H01431  Cushing syndrome
H01570  Autosomal dominant striatal degeneration
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Bemoradan: D03075
Bucladesine (DG00230): D01238<JP> D07546
Choline theophyllinate: D02017
Diprophylline: D00691<JP>
Enprofylline: D04006
Flavoxate (DG00477): D00718<JP/US> D07961
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Prinoxodan: D05612
Proxyphylline: D01771<JP>
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    8622 (PDE8B)
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    8622 (PDE8B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    8622 (PDE8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    8622 (PDE8B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     8622 (PDE8B)
SSDB
Motif
Pfam: PDEase_I PDE8 PAS_9 PAS PAS_3 PAS_4 PAS_8
Other DBs
NCBI-GeneID: 8622
NCBI-ProteinID: NP_003710
OMIM: 603390
HGNC: 8794
Ensembl: ENSG00000113231 ENSG00000284762
Vega: OTTHUMG00000102170
Pharos: O95263(Tclin)
UniProt: O95263 B3KN77
LinkDB
Position
5q13.3
AA seq 885 aa
MGCAPSIHVSQSGVIYCRDSDESSSPRQTTSVSQGPAAPLPGLFVQTDAADAIPPSRASG
PPSVARVRRARTELGSGSSAGSAAPAATTSRGRRRHCCSSAEAETQTCYTSVKQVSSAEV
RIGPMRLTQDPIQVLLIFAKEDSQSDGFWWACDRAGYRCNIARTPESALECFLDKHHEII
VIDHRQTQNFDAEAVCRSIRATNPSEHTVILAVVSRVSDDHEEASVLPLLHAGFNRRFME
NSSIIACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHEAIEITSDDHVIQYVNPAFER
MMGYHKGELLGKELADLPKSDKNRADLLDTINTCIKKGKEWQGVYYARRKSGDSIQQHVK
ITPVIGQGGKIRHFVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDV
KSISSRGSDAPSLQNRRYPSMARIHSMTIEAPITKVINIINAAQENSPVTVAEALDRVLE
ILRTTELYSPQLGTKDEDPHTSDLVGGLMTDGLRRLSGNEYVFTKNVHQSHSHLAMPITI
NDVPPCISQLLDNEESWDFNIFELEAITHKRPLVYLGLKVFSRFGVCEFLNCSETTLRAW
FQVIEANYHSSNAYHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHP
GRTNSFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDTKCNIFKNIDRNHYRTLRQAI
IDMVLATEMTKHFEHVNKFVNSINKPMAAEIEGSDCECNPAGKNFPENQILIKRMMIKCA
DVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYF
ITDMFDAWDAFAHLPALMQHLADNYKHWKTLDDLKCKSLRLPSDS
NT seq 2658 nt   +upstreamnt  +downstreamnt
atgggctgcgcccccagcatccatgtctcgcagagcggcgtgatctactgccgggactcg
gacgagtccagctcgccccgccagaccaccagcgtgtcgcagggcccggcggcacccctg
cccggcctcttcgtccagaccgacgccgccgacgccatccccccgagccgcgcgtcggga
ccccccagcgtagcccgcgtccgcagggcccgcaccgagctgggcagcggtagcagcgcg
ggttccgcagcccccgccgcgaccaccagcaggggccggaggcgccactgctgcagcagc
gccgaggccgagactcagacctgctacaccagcgtgaagcaggtgtcttctgcggaggtg
cgcatcgggcccatgagactgacgcaggaccctattcaggttttgctgatctttgcaaag
gaagatagtcagagcgatggcttctggtgggcctgcgacagagctggttatagatgcaat
attgctcggactccagagtcagcccttgaatgctttcttgataagcatcatgaaattatt
gtaattgatcatagacaaactcagaacttcgatgcagaagcagtgtgcaggtcgatccgg
gccacaaatccctccgagcacacggtgatcctcgcagtggtttcgcgagtatcggatgac
catgaagaggcgtcagtccttcctcttctccacgcaggcttcaacaggagatttatggag
aatagcagcataattgcttgctataatgaactgattcaaatagaacatggggaagttcgc
tcccagttcaaattacgggcctgtaattcagtgtttacagcattagatcactgtcatgaa
gccatagaaataacaagcgatgaccacgtgattcagtatgtcaacccagccttcgaaagg
atgatgggctaccacaaaggtgagctcctgggaaaagaactcgctgatctgcccaaaagc
gataagaaccgggcagaccttctcgacaccatcaatacatgcatcaagaagggaaaggag
tggcagggggtttactatgccagacggaaatccggggacagcatccaacagcacgtgaag
atcaccccagtgattggccaaggagggaaaattaggcattttgtctcgctcaagaaactg
tgttgtaccactgacaataataagcagattcacaagattcatcgtgattcaggagacaat
tctcagacagagcctcattcattcagatataagaacaggaggaaagagtccattgacgtg
aaatcgatatcatctcgaggcagtgatgcaccaagcctgcagaatcgtcgctatccgtcc
atggcgaggatccactccatgaccatcgaggctcccatcacaaaggttataaatataatc
aatgcagcccaagaaaacagcccagtcacagtagcggaagccttggacagagttctagag
attttacggaccacagaactgtactcccctcagctgggtaccaaagatgaagatccccac
accagtgatcttgttggaggcctgatgactgacggcttgagaagactgtcaggaaacgag
tatgtgtttactaagaatgtgcaccagagtcacagtcaccttgcaatgccaataaccatc
aatgatgttcccccttgtatctctcaattacttgataatgaggagagttgggacttcaac
atctttgaattggaagccattacgcataaaaggccattggtttatctgggcttaaaggtc
ttctctcggtttggagtatgtgaatttttaaactgttctgaaaccactcttcgggcctgg
ttccaagtgatcgaagccaactaccactcttccaatgcctaccacaactccacccatgct
gccgacgtcctgcacgccaccgctttctttcttggaaaggaaagagtaaagggaagcctc
gatcagttggatgaggtggcagccctcattgctgccacagtccatgacgtggatcacccg
ggaaggaccaactctttcctctgcaatgcaggcagtgagcttgctgtgctctacaatgac
actgctgttctggagagtcaccacaccgccctggccttccagctcacggtcaaggacacc
aaatgcaacattttcaagaatattgacaggaaccattatcgaacgctgcgccaggctatt
attgacatggttttggcaacagagatgacaaaacactttgaacatgtgaataagtttgtg
aacagcatcaacaagccaatggcagctgagattgaaggcagcgactgtgaatgcaaccct
gctgggaagaacttccctgaaaaccaaatcctgatcaaacgcatgatgattaagtgtgct
gacgtggccaacccatgccgccccttggacctgtgcattgaatgggctgggaggatctct
gaggagtattttgcacagactgatgaagagaagagacagggactacctgtggtgatgcca
gtgtttgaccggaatacctgtagcatccccaagtctcagatctctttcattgactacttc
ataacagacatgtttgatgcttgggatgcctttgcacatctgccagccctgatgcaacat
ttggctgacaactacaaacactggaagacactagatgacctaaagtgcaaaagtttgagg
cttccatctgacagctaa

DBGET integrated database retrieval system