KEGG   Homo sapiens (human): 10846Help
Entry
10846             CDS       T01001                                 

Gene name
PDE10A, ADSD2, HSPDE10A, IOLOD, LINC00473, PDE10A19
Definition
(RefSeq) phosphodiesterase 10A
  KO
K18438  cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10 [EC:3.1.4.17 3.1.4.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04024  cAMP signaling pathway
hsa05032  Morphine addiction
Disease
H01570  Autosomal dominant striatal degeneration
Drug target
Aminophylline (DG01062): D00227 D05429 D11630
Balipodect: D11245
Bemoradan: D03075
Bucladesine (DG00230): D01238 D07546
Choline theophyllinate: D02017
Diprophylline: D00691
Enprofylline: D04006
Flavoxate (DG00477): D00718 D07961
Mardepodect: D11171
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218 D07425 D07439
Prinoxodan: D05612
Proxyphylline: D01771
Theophylline (DG01061): D00371 D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    10846 (PDE10A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    10846 (PDE10A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    10846 (PDE10A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     10846 (PDE10A)
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     10846 (PDE10A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3 SpoVT_C HD H_kinase_N DUF4748
Motif
Other DBs
NCBI-GeneID: 10846
NCBI-ProteinID: NP_006652
OMIM: 610652
HGNC: 8772
Ensembl: ENSG00000112541
Vega: OTTHUMG00000015986
Pharos: Q9Y233(Tclin)
UniProt: Q9Y233 A0A1B1UZR0
LinkDB All DBs
Structure
PDB: 

Position
6q27
AA seq 779 aa AA seqDB search
MRIEERKSQHLTGLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRKNNKSEDESAP
KEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGEC
NNSLCIFTPPGIKEGKPRLIPAGPITQGTTVSAYVAKSRKTLLVEDILGDERFPRGTGLE
SGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWASVAIHQVQVC
RGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELY
SDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYT
GYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYHR
IRHSECIYRVTMEKLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIF
VYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTD
LERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNI
FSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMM
TACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFY
NAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSVAQKAAASED
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgaggatagaagagaggaaatcccaacatttaacaggtttgacagatgaaaaagtgaag
gcatatctttctcttcacccccaggtattagatgaatttgtatctgaaagtgttagtgca
gagacagtagagaaatggctgaagaggaagaacaacaaatcagaagatgaatcagctcct
aaggaagtcagcaggtaccaagatacgaatatgcagggagttgtatatgaactaaacagc
tatatagaacaacggttggacacaggaggagacaaccagctactcctctatgaactgagc
agcatcattaaaatagccacaaaagccgatggatttgcactgtatttccttggagagtgc
aataatagcctgtgtatattcacgccacctgggataaaggaaggaaaaccccgcctcatc
cctgctgggcccatcactcagggcaccaccgtctctgcttatgtggccaagtccaggaaa
acactgctagtagaagacatccttggagatgaacgatttccaagaggtactggactggaa
tcagggactcgtatccagtctgttctttgcttaccaattgtcactgcaattggtgacttg
attggtattctcgagctgtatcggcactggggcaaagaagccttctgtcttagtcaccag
gaggttgcaacagcaaatcttgcctgggcttcagtagcaatacatcaggtgcaggtatgc
agaggccttgccaaacagacagaattgaatgacttcctactcgacgtatcaaaaacatat
tttgataacatagttgcaatagattctctacttgaacacataatgatatatgcaaaaaac
ctggtgaatgccgatcgttgtgcgcttttccaggtggaccataagaacaaggagttatat
tcagacctttttgatattggagaggaaaaggaaggaaaacctgtcttcaagaagaccaaa
gagataagattttcaattgagaaaggaattgctggccaagtagcaagaacaggggaagtc
ctgaacattccagatgcctatgcagacccacgctttaacagagaagtagacttgtacaca
ggctacaccacgcggaacatcctgtgcatgcccatcgtcagccgaggcagcgtgataggt
gtggtgcagatggtcaacaaaatcagtggcagtgccttctctaaaacagatgaaaacaac
ttcaaaatgtttgccgtcttttgtgctttagccttacactgtgctaatatgtatcataga
attcgccactcagagtgcatttaccgggtaacgatggaaaagctgtcctaccatagcatt
tgtacttcagaagagtggcaaggtctcatgcaattcacccttcccgtgcgtctctgcaaa
gaaattgaattattccactttgacattggtccttttgaaaacatgtggcctggaattttt
gtctacatggttcatcggtcctgtgggacatcctgctttgagcttgaaaagttgtgtcgt
tttattatgtctgtgaagaagaactatcggcgggttccttatcacaactggaagcatgcg
gtcactgtagcacactgcatgtatgccatacttcagaacaatcacacgcttttcacagac
cttgagcgcaaaggactgctgattgcgtgtctgtgtcatgacctggaccacaggggcttc
agtaacagctacctgcagaagttcgaccaccctctggccgctctctactccacttccacc
atggagcagcaccacttctcccagactgtgtccatcctccagttggaagggcacaatatc
ttctccactctgagctccagtgaatatgagcaggtgcttgagatcatccgcaaagccatc
attgccacagaccttgctttatactttggaaacaggaagcagttggaagagatgtaccag
accggatcactaaaccttaataatcaatcacatagagaccgtgtaattggtttgatgatg
actgcctgtgacctttgttctgtgacaaaactgtggcccgttacaaaattgacggcaaat
gatatatatgcagaattctgggctgagggtgatgaaatgaagaaattgggaatacagcct
attcctatgatggacagagacaagaaggatgaagtcccccaaggccagcttgggttctac
aatgccgtggccattccctgctatacaacccttacccagatcctccctcccacggagcct
cttctgaaagcatgcagggataatctcagtcagtgggagaaggtgattcgaggggaggag
actgcaacctggatttcatccccatccgtggctcagaaggcagctgcatctgaagattga

KEGG   Homo sapiens (human): 5139Help
Entry
5139              CDS       T01001                                 

Gene name
PDE3A, CGI-PDE, CGI-PDE_A, CGI-PDE-A, HTNB
Definition
(RefSeq) phosphodiesterase 3A
  KO
K19021  cGMP-inhibited 3',5'-cyclic phosphodiesterase A [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04924  Renin secretion
hsa05032  Morphine addiction
Disease
H00482  Brachydactyly
Drug target
Aminophylline (DG01062): D00227 D05429 D11630
Amrinone (DG00228): D00231 D02084
Anagrelide (DG00727): D02933 D07455 D10255
Bemoradan: D03075
Beradilol monoethyl maleate: D09843
Bucladesine (DG00230): D01238 D07546
Caffeine (DG00974): D00528 D01453 D07603
Choline theophyllinate: D02017
Cilostazol: D01896
Diprophylline: D00691
Enoximone: D04004
Enprofylline: D04006
Flavoxate (DG00477): D00718 D07961
Ibudilast: D01385
Imazodan hydrochloride: D04508
Indolidan: D04529
Isomazole hydrochloride: D04628
Levosimendan: D04720
Lixazinone sulfate: D04751
Milrinone (DG00229): D00417 D02085
Moxaverine (DG00045): D07089 D08238
Olprinone (DG01396): D02042 D08294
Oxagrelate: D05278
Papaverine (DG00043): D02218 D07425 D07439
Pimobendan: D01133
Piroximone: D05514
Prinoxodan: D05612
Proxyphylline: D01771
Theophylline (DG01061): D00371 D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Toborinone: D01198
Trapidil: D01220
Vesnarinone: D01690
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5139 (PDE3A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    5139 (PDE3A)
   04022 cGMP-PKG signaling pathway
    5139 (PDE3A)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    5139 (PDE3A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5139 (PDE3A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     5139 (PDE3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I
Motif
Other DBs
NCBI-GeneID: 5139
NCBI-ProteinID: NP_000912
OMIM: 123805
HGNC: 8778
Ensembl: ENSG00000172572
Vega: OTTHUMG00000168962
Pharos: Q14432(Tclin)
UniProt: Q14432
LinkDB All DBs
Position
12p12.2
AA seq 1141 aa AA seqDB search
MAVPGDAARVRDKPVHSGVSQAPTAGRDCHHRADPASPRDSGCRGCWGDLVLQPLRSSRK
LSSALCAGSLSFLLALLVRLVRGEVGCDLEQCKEAAAAEEEEAAPGAEGGVFPGPRGGAP
GGGARLSPWLQPSALLFSLLCAFFWMGLYLLRAGVRLPLAVALLAACCGGEALVQIGLGV
GEDHLLSLPAAGVVLSCLAAATWLVLRLRLGVLMIALTSAVRTVSLISLERFKVAWRPYL
AYLAGVLGILLARYVEQILPQSAEAAPREHLGSQLIAGTKEDIPVFKRRRRSSSVVSAEM
SGCSSKSHRRTSLPCIPREQLMGHSEWDHKRGPRGSQSSGTSITVDIAVMGEAHGLITDL
LADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSDSEESSEKDKLA
IPKRLRRSLPPGLLRRVSSTWTTTTSATGLPTLEPAPVRRDRSTSIKLQEAPSSSPDSWN
NPVMMTLTKSRSFTSSYAISAANHVKAKKQSRPGALAKISPLSSPCSSPLQGTPASSLVS
KISAVQFPESADTTAKQSLGSHRALTYTQSAPDLSPQILTPPVICSSCGRPYSQGNPADE
PLERSGVATRTPSRTDDTAQVTSDYETNNNSDSSDIVQNEDETECLREPLRKASACSTYA
PETMMFLDKPILAPEPLVMDNLDSIMEQLNTWNFPIFDLVENIGRKCGRILSQVSYRLFE
DMGLFEAFKIPIREFMNYFHALEIGYRDIPYHNRIHATDVLHAVWYLTTQPIPGLSTVIN
DHGSTSDSDSDSGFTHGHMGYVFSKTYNVTDDKYGCLSGNIPALELMALYVAAAMHDYDH
PGRTNAFLVATSAPQAVLYNDRSVLENHHAAAAWNLFMSRPEYNFLINLDHVEFKHFRFL
VIEAILATDLKKHFDFVAKFNGKVNDDVGIDWTNENDRLLVCQMCIKLADINGPAKCKEL
HLQWTDGIVNEFYEQGDEEASLGLPISPFMDRSAPQLANLQESFISHIVGPLCNSYDSAG
LMPGKWVEDSDESGDTDDPEEEEEEAPAPNEEETCENNESPKKKTFKRRKIYCQITQHLL
QNHKMWKKVIEEEQRLAGIENQSLDQTPQSHSSEQIQAIKEEEEEKGKPRGEEIPTQKPD
Q
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgcccggcgacgctgcacgagtcagggacaagcccgtccacagtggggtgagt
caagcccccacggcgggccgggactgccaccatcgtgcggaccccgcatcgccgcgggac
tcgggctgccgtggctgctggggagacctggtgctgcagccgctccggagctctcggaaa
ctttcctccgcgctgtgcgcgggctccctgtcctttctgctggcgctgctggtgaggctg
gtccgcggggaggtcggctgtgacctggagcagtgtaaggaggcggcggcggcggaggag
gaggaagcagccccgggagcagaagggggcgtcttcccggggcctcggggaggtgctccc
gggggcggtgcgcggctcagcccctggctgcagccctcggcgctgctcttcagtctcctg
tgtgccttcttctggatgggcttgtacctcctgcgcgccggggtgcgcctgcctctggct
gtcgcgctgctggccgcctgctgcgggggggaagcgctcgtccagattgggctgggcgtc
ggggaggatcacttactctcactccccgccgcgggggtggtgctcagctgcttggccgcc
gcgacatggctggtgctgaggctgaggctgggcgtcctcatgatcgccttgactagcgcg
gtcaggaccgtgtccctcatttccttagagaggttcaaggtcgcctggagaccttacctg
gcgtacctggccggcgtgctggggatcctcttggccaggtacgtggaacaaatcttgccg
cagtccgcggaggcggctccaagggagcatttggggtcccagctgattgctgggaccaag
gaagatatcccggtgtttaagaggaggaggcggtccagctccgtcgtgtccgccgagatg
tccggctgcagcagcaagtcccatcggaggacctccctgccctgtataccgagggaacag
ctcatggggcattcagaatgggaccacaaacgagggccaagaggatcacagtcttcagga
accagtattactgtggacatcgccgtcatgggcgaggcccacggcctcattaccgacctc
ctggcagacccttctcttccaccaaacgtgtgcacatccttgagagccgtgagcaacttg
ctcagcacacagctcaccttccaggccattcacaagcccagagtgaatcccgtcacttcg
ctcagtgaaaactatacctgttctgactctgaagagagctctgaaaaagacaagcttgct
attccaaagcgcctgagaaggagtttgcctcctggcttgttgagacgagtttcttccact
tggaccaccaccacctcggccacaggtctacccaccttggagcctgcaccagtacggaga
gaccgcagcaccagcatcaaactgcaggaagcaccttcatccagtcctgattcttggaat
aatccagtgatgatgaccctcaccaaaagcagatcctttacttcatcctatgctatttct
gcagctaaccatgtaaaggctaaaaagcaaagtcgaccaggtgccctcgctaaaatttca
cctctttcatcgccctgctcctcacctctccaagggactcctgccagcagcctggtcagc
aaaatttctgcagtgcagtttccagaatctgctgacacaactgccaaacaaagcctaggt
tctcacagggccttaacttacactcagagtgccccagacctatcccctcaaatcctgact
ccacctgttatatgtagcagctgtggcagaccatattcccaagggaatcctgctgatgag
cccctggagagaagtggggtagccactcggacaccaagtagaacagatgacactgctcaa
gttacctctgattatgaaaccaataacaacagtgacagcagtgacattgtacagaatgaa
gatgaaacagagtgcctgagagagcctctgaggaaagcatcggcttgcagcacctatgct
cctgagaccatgatgtttctggacaaaccaattcttgctcccgaacctcttgtcatggat
aacctggactcaattatggagcagctaaatacttggaattttccaatttttgatttagtg
gaaaatataggaagaaaatgtggccgtattcttagtcaggtatcttacagactttttgaa
gacatgggcctctttgaagcttttaaaattccaattagggaatttatgaattattttcat
gctttggagattggatatagggatattccttatcataacagaatccatgccactgatgtt
ttacatgctgtttggtatcttactacacagcctattccaggcctctcaactgtgattaat
gatcatggttcaaccagtgattcagattctgacagtggatttacacatggacatatggga
tatgtattctcaaaaacgtataatgtgacagatgataaatacggatgtctgtctgggaat
atccctgccttggagttgatggcgctgtatgtggctgcagccatgcacgattatgatcat
ccaggaaggactaatgctttcctggttgcaactagtgctcctcaggcggtgctatataac
gatcgttcagttttggagaatcatcacgcagctgctgcatggaatcttttcatgtcccgg
ccagagtataacttcttaattaaccttgaccatgtggaatttaagcatttccgtttcctt
gtcattgaagcaattttggccactgacctgaagaaacactttgacttcgtagccaaattt
aatggcaaggtaaatgatgatgttggaatagattggaccaatgaaaatgatcgtctactg
gtttgtcaaatgtgtataaagttggctgatatcaatggtccagctaaatgtaaagaactc
catcttcagtggacagatggtattgtcaatgaattttatgaacagggtgatgaagaggcc
agccttggattacccataagccccttcatggatcgttctgctcctcagctggccaacctt
caggaatccttcatctctcacattgtggggcctctgtgcaactcctatgattcagcagga
ctaatgcctggaaaatgggtggaagacagcgatgagtcaggagatactgatgacccagaa
gaagaggaggaagaagcaccagcaccaaatgaagaggaaacctgtgaaaataatgaatct
ccaaaaaagaagactttcaaaaggagaaaaatctactgccaaataactcagcacctctta
cagaaccacaagatgtggaagaaagtcattgaagaggagcaacggttggcaggcatagaa
aatcaatccctggaccagacccctcagtcgcactcttcagaacagatccaggctatcaag
gaagaagaagaagagaaagggaaaccaagaggcgaggagataccaacccaaaagccagac
cagtga

KEGG   Homo sapiens (human): 5140Help
Entry
5140              CDS       T01001                                 

Gene name
PDE3B, HcGIP1, cGIPDE1
Definition
(RefSeq) phosphodiesterase 3B
  KO
K13296  cGMP-inhibited 3',5'-cyclic phosphodiesterase B [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04371  Apelin signaling pathway
hsa04910  Insulin signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04922  Glucagon signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429 D11630
Amrinone (DG00228): D00231 D02084
Anagrelide (DG00727): D02933 D07455 D10255
Bemoradan: D03075
Beradilol monoethyl maleate: D09843
Bucladesine (DG00230): D01238 D07546
Caffeine (DG00974): D00528 D01453 D07603
Choline theophyllinate: D02017
Cilostazol: D01896
Diprophylline: D00691
Enoximone: D04004
Enprofylline: D04006
Flavoxate (DG00477): D00718 D07961
Ibudilast: D01385
Imazodan hydrochloride: D04508
Indolidan: D04529
Isomazole hydrochloride: D04628
Levosimendan: D04720
Lixazinone sulfate: D04751
Milrinone (DG00229): D00417 D02085
Moxaverine (DG00045): D07089 D08238
Olprinone (DG01396): D02042 D08294
Oxagrelate: D05278
Papaverine (DG00043): D02218 D07425 D07439
Pimobendan: D01133
Piroximone: D05514
Prinoxodan: D05612
Proxyphylline: D01771
Theophylline (DG01061): D00371 D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Toborinone: D01198
Trapidil: D01220
Vesnarinone: D01690
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5140 (PDE3B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    5140 (PDE3B)
   04024 cAMP signaling pathway
    5140 (PDE3B)
   04022 cGMP-PKG signaling pathway
    5140 (PDE3B)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5140 (PDE3B)
   04922 Glucagon signaling pathway
    5140 (PDE3B)
   04923 Regulation of lipolysis in adipocytes
    5140 (PDE3B)
   04914 Progesterone-mediated oocyte maturation
    5140 (PDE3B)
   04924 Renin secretion
    5140 (PDE3B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5140 (PDE3B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     5140 (PDE3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I DUF1129
Motif
Other DBs
NCBI-GeneID: 5140
NCBI-ProteinID: NP_000913
OMIM: 602047
HGNC: 8779
Ensembl: ENSG00000152270
Vega: OTTHUMG00000165898
Pharos: Q13370(Tclin)
UniProt: Q13370 A7E2E5
LinkDB All DBs
Structure
PDB: 

Position
11p15.2
AA seq 1112 aa AA seqDB search
MRRDERDAKAMRSLQPPDGAGSPPESLRNGYVKSCVSPLRQDPPRGFFFHLCRFCNVELR
PPPASPQQPRRCSPFCRARLSLGALAAFVLALLLGAEPESWAAGAAWLRTLLSVCSHSLS
PLFSIACAFFFLTCFLTRTKRGPGPGRSCGSWWLLALPACCYLGDFLVWQWWSWPWGDGD
AGSAAPHTPPEAAAGRLLLVLSCVGLLLTLAHPLRLRHCVLVLLLASFVWWVSFTSLGSL
PSALRPLLSGLVGGAGCLLALGLDHFFQIREAPLHPRLSSAAEEKVPVIRPRRRSSCVSL
GETAASYYGSCKIFRRPSLPCISREQMILWDWDLKQWYKPHYQNSGGGNGVDLSVLNEAR
NMVSDLLTDPSLPPQVISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCSEIEDPAEKG
DRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGP
FNSNLLTIPKQRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVSTGSLTNRSPIEFPDT
ADFLNKPSVILQRSLGNAPNTPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSG
KSGEEENIFSKESFKLMETQQEEETEKKDSRKLFQEGDKWLTEEAQSEQQTNIEQEVSLD
LILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVMYTLFQDTGLLEIFKIPTQQF
MNYFRALENGYRDIPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNGCGTGNETDSDGRIN
HGRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQ
AVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFD
FLAEFNAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFY
EQGDEEANLGLPISPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLEAEEDN
DTESGDDEDGEELDTEDEEMENNLNPKPPRRKSRRRIFCQLMHHLTENHKIWKEIVEEEE
KCKADGNKLQVENSSLPQADEIQVIEEADEEE
NT seq 3339 nt NT seq  +upstreamnt  +downstreamnt
atgaggagggacgagcgagacgccaaagccatgcggtccctgcagccgccggatggggcc
ggctcgccccccgagagtctgaggaacggctacgtgaagagctgcgtgagccccttgcgg
caggaccctccgcgcggcttcttcttccacctctgccgcttctgcaacgtggagctgcgg
ccgccgccggcctctccccagcagccgcggcgctgctcccccttctgccgggcgcgcctc
tcgctgggcgccctggctgcctttgtcctcgccctgctgctgggcgcggaacccgagagc
tgggctgccggggccgcctggctgcggacgctgctgagcgtgtgttcgcacagcttgagc
cccctcttcagcatcgcctgtgccttcttcttcctcacctgcttcctcacccggaccaag
cggggacccggcccgggccggagctgcggctcctggtggctgctggcgctgcccgcctgc
tgttacctgggggacttcttggtgtggcagtggtggtcttggccttggggggatggcgac
gcagggtccgcggccccgcacacgcccccggaggcggcagcgggcaggttgctgctggtg
ctgagctgcgtagggctgctgctgacgctcgcgcacccgctgcggctccggcactgcgtt
ctggtgctgctcctggccagcttcgtctggtgggtctccttcaccagcctcgggtcgctg
ccctccgccctcaggccgctgctctccggcctggtggggggcgctggctgcctgctggcc
ctggggttggatcacttctttcaaatcagggaagcgcctcttcatcctcgactgtccagt
gccgccgaagaaaaagtgcctgtgatccgaccccggaggaggtccagctgcgtgtcgtta
ggagaaactgcagccagttactatggcagttgcaaaatattcaggagaccgtcgttgcct
tgtatttccagagaacagatgattctttgggattgggacttaaaacaatggtataagcct
cattatcaaaattctggaggtggaaatggagttgatctttcagtgctaaatgaggctcgc
aatatggtgtcagatcttctgactgatccaagccttccaccacaagtcatttcctctcta
cggagtattagtagcttaatgggtgctttctcaggttcctgtaggccaaagattaatcct
ctcacaccatttcctggattttacccctgttctgaaatagaggacccagctgagaaaggg
gatagaaaacttaacaagggactaaataggaatagtttgccaactccacagctgaggaga
agctcaggaacttcaggattgctacctgttgaacagtcttcaaggtgggatcgtaataat
ggcaaaagacctcaccaagaatttggcatttcaagtcaaggatgctatctaaatgggcct
tttaattcaaatctactgactatcccgaagcaaaggtcatcttctgtatcactgactcac
catgtaggtctcagaagagctggtgttttgtccagtctgagtcctgtgaattcttccaac
catggaccagtgtctactggctctctaactaatcgatcacccatagaatttcctgatact
gctgattttcttaataagccaagcgttatcttgcagagatctctgggcaatgcacctaat
actccagatttttatcagcaacttagaaattctgatagcaatctgtgtaacagctgtgga
catcaaatgctgaaatatgtttcaacatctgaatcagatggtacagattgctgcagtgga
aaatcaggtgaagaagaaaacattttctcgaaagaatcattcaaacttatggaaactcaa
caagaagaggaaacagagaagaaagacagcagaaaattatttcaggaaggtgataagtgg
ctaacagaagaggcacagagtgaacagcaaacaaatattgaacaggaagtatcactggac
ctgattttagtagaagagtatgactcattaatagaaaagatgagcaactggaattttcca
atttttgaacttgtagaaaagatgggagagaaatcaggaaggattctcagtcaggttatg
tataccttatttcaagacactggtttattggaaatatttaaaattcccactcaacaattt
atgaactattttcgtgcattagaaaatggctatcgagacattccttatcacaatcgtata
catgccacagatgtgctacatgcagtttggtatctgacaacacggccagttcctggctta
cagcagatccacaatggttgtggaacaggaaatgaaacagattctgatggtagaattaac
catgggcgaattgcttatatttcttcgaagagctgctctaatcctgatgagagttatggc
tgcctgtcttcaaacattcctgcattagaattgatggctctatacgtggcagctgccatg
catgattatgatcacccagggaggacaaatgcatttctagtggctacaaatgcccctcag
gcagttttatacaatgacagatctgttctggaaaatcatcatgctgcgtcagcttggaat
ctatatctttctcgcccagaatacaacttccttcttcatcttgatcatgtggaattcaag
cgctttcgttttttagtcattgaagcaatccttgctacggatcttaaaaagcattttgat
tttctcgcagaattcaatgccaaggcaaatgatgtaaatagtaatggcatagaatggagt
aatgaaaatgatcgcctcttggtatgccaggtgtgcatcaaactggcagatataaatggc
ccagcaaaagttcgagacttgcatttgaaatggacagaaggcattgtcaatgaattttat
gagcagggagatgaagaagcaaatcttggtctgcccatcagtccattcatggatcgttct
tctcctcaactagcaaaactccaagaatcttttatcacccacatagtgggtcccctgtgt
aactcctatgatgctgctggtttgctaccaggtcagtggttagaagcagaagaggataat
gatactgaaagtggtgatgatgaagacggtgaagaattagatacagaagatgaagaaatg
gaaaacaatctaaatccaaaaccaccaagaaggaaaagcagacggcgaatattttgtcag
ctaatgcaccacctcactgaaaaccacaagatatggaaggaaatcgtagaggaagaagaa
aaatgtaaagctgatgggaataaactgcaggtggagaattcctccttacctcaagcagat
gagattcaggtaattgaagaggcagatgaagaggaatag

KEGG   Homo sapiens (human): 5141Help
Entry
5141              CDS       T01001                                 

Gene name
PDE4A, DPDE2, PDE4, PDE46
Definition
(RefSeq) phosphodiesterase 4A
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04024  cAMP signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429 D11630
Apremilast: D08860
Arofylline: D02985
Bemoradan: D03075
Bucladesine (DG00230): D01238 D07546
Caffeine (DG00974): D00528 D01453 D07603
Choline theophyllinate: D02017
Cilomilast: D01704
Cipamfylline: D03516
Crisaborole: D10873
Difamilast: D11314
Diprophylline: D00691
Dipyridamole: D00302
Drotaverine (DG00044): D07088 D07879
Enprofylline: D04006
Etazolate hydrochloride: D02655
Filaminast: D04185
Flavoxate (DG00477): D00718 D07961
Ibudilast: D01385
Lotamilast: D11305
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218 D07425 D07439
Piclamilast: D05474
Prinoxodan: D05612
Propentofylline: D01630
Proxyphylline: D01771
Roflumilast: D05744
Rolipram: D01783
Theophylline (DG01061): D00371 D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Tofimilast: D09020
Trapidil: D01220
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5141 (PDE4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    5141 (PDE4A)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    5141 (PDE4A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5141 (PDE4A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     5141 (PDE4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I PDE4_UCR NadA DUF5405
Motif
Other DBs
NCBI-GeneID: 5141
NCBI-ProteinID: NP_001104777
OMIM: 600126
HGNC: 8780
Ensembl: ENSG00000065989
Vega: OTTHUMG00000180411
Pharos: P27815(Tclin)
UniProt: P27815
LinkDB All DBs
Structure
PDB: 

Position
19p13.2
AA seq 886 aa AA seqDB search
MEPPTVPSERSLSLSLPGPREGQATLKPPPQHLWRQPRTPIRIQQRGYSDSAERAERERQ
PHRPIERADAMDTSDRPGLRTTRMSWPSSFHGTGTGSGGAGGGSSRRFEAENGPTPSPGR
SPLDSQASPGLVLHAGAATSQRRESFLYRSDSDYDMSPKTMSRNSSVTSEAHAEDLIVTP
FAQVLASLRSVRSNFSLLTNVPVPSNKRSPLGGPTPVCKATLSEETCQQLARETLEELDW
CLEQLETMQTYRSVSEMASHKFKRMLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVEI
PSPTMKEREKQQAPRPRPSQPPPPPVPHLQPMSQITGLKKLMHSNSLNNSNIPRFGVKTD
QEELLAQELENLNKWGLNIFCVSDYAGGRSLTCIMYMIFQERDLLKKFRIPVDTMVTYML
TLEDHYHADVAYHNSLHAADVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPGV
SNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEDNCDIFQNLSKRQRQSLRKMVIDM
VLATDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPLE
LYRQWTDRIMAEFFQQGDRERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADL
VHPDAQEILDTLEDNRDWYYSAIRQSPSPPPEEESRGPGHPPLPDKFQFELTLEEEEEEE
ISMAQIPCTAQEALTAQGLSGVEEALDATIAWEASPAQESLEVMAQEASLEAELEAVYLT
QQAQSTGSAPVAPDEFSSREEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHAPGLPGLP
STAAEVEAQREHQAAKRACSACAGTFGEDTSALPAPGGGGSGGDPT
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atggaacccccgaccgtcccctcggaaaggagcctgtctctgtcactgcccgggccccgg
gagggccaggccaccctgaagcctcccccgcagcacctgtggcggcagcctcggaccccc
atccgtatccagcagcgcggctactccgacagcgcggagcgcgccgagcgggagcggcag
ccgcaccggcccatagagcgcgccgatgccatggacaccagcgaccggcccggcctgcgc
acgacccgcatgtcctggccctcgtccttccatggcactggcaccggcagcggcggcgcg
ggcggaggcagcagcaggcgcttcgaggcagagaatgggccgacaccatctcctggccgc
agccccctggactcgcaggcgagcccaggactcgtgctgcacgccggggcggccaccagc
cagcgccgggagtccttcctgtaccgctcagacagcgactatgacatgtcacccaagacc
atgtcccggaactcatcggtcaccagcgaggcgcacgctgaagacctcatcgtaacacca
tttgctcaggtgctggccagcctccggagcgtccgtagcaacttctcactcctgaccaat
gtgcccgttcccagtaacaagcggtccccgctgggcggccccacccctgtctgcaaggcc
acgctgtcagaagaaacgtgtcagcagttggcccgggagactctggaggagctggactgg
tgtctggagcagctggagaccatgcagacctatcgctctgtcagcgagatggcctcgcac
aagttcaaaaggatgttgaaccgtgagctcacacacctgtcagaaatgagcaggtccgga
aaccaggtctcagagtacatttccacaacattcctggacaaacagaatgaagtggagatc
ccatcacccacgatgaaggaacgagaaaaacagcaagcgccgcgaccaagaccctcccag
ccgcccccgccccctgtaccacacttacagcccatgtcccaaatcacagggttgaaaaag
ttgatgcatagtaacagcctgaacaactctaacattccccgatttggggtgaagaccgat
caagaagagctcctggcccaagaactggagaacctgaacaagtggggcctgaacatcttt
tgcgtgtcggattacgctggaggccgctcactcacctgcatcatgtacatgatattccag
gagcgggacctgctgaagaaattccgcatccctgtggacacgatggtgacatacatgctg
acgctggaggatcactaccacgctgacgtggcctaccataacagcctgcacgcagctgac
gtgctgcagtccacccacgtactgctggccacgcctgcactagatgcagtgttcacggac
ctggagattctcgccgccctcttcgcggctgccatccacgatgtggatcaccctggggtc
tccaaccagttcctcatcaacaccaattcggagctggcgctcatgtacaacgatgagtcg
gtgctcgagaatcaccacctggccgtgggcttcaagctgctgcaggaggacaactgcgac
atcttccagaacctcagcaagcgccagcggcagagcctacgcaagatggtcatcgacatg
gtgctggccacggacatgtccaagcacatgaccctcctggctgacctgaagaccatggtg
gagaccaagaaagtgaccagctcaggggtcctcctgctagataactactccgaccgcatc
caggtcctccggaacatggtgcactgtgccgacctcagcaaccccaccaagccgctggag
ctgtaccgccagtggacagaccgcatcatggccgagttcttccagcagggtgaccgagag
cgcgagcgtggcatggaaatcagccccatgtgtgacaagcacactgcctccgtggagaag
tctcaggtgggttttattgactacattgtgcacccattgtgggagacctgggcggacctt
gtccacccagatgcccaggagatcttggacactttggaggacaaccgggactggtactac
agcgccatccggcagagcccatctccgccacccgaggaggagtcaagggggccaggccac
ccacccctgcctgacaagttccagtttgagctgacgctggaggaggaagaggaggaagaa
atatcaatggcccagataccgtgcacagcccaagaggcattgactgcgcagggattgtca
ggagtcgaggaagctctggatgcaaccatagcctgggaggcatccccggcccaggagtcg
ttggaagttatggcacaggaagcatccctggaggccgagctggaggcagtgtatttgaca
cagcaggcacagtccacaggcagtgcacctgtggctccggatgagttctcgtcccgggag
gaattcgtggttgctgtaagccacagcagcccctctgccctggctcttcaaagccccctt
ctccctgcttggaggaccctgtctgtttcagagcatgccccgggcctcccgggcctcccc
tccacggcggccgaggtggaggcccaacgagagcaccaggctgccaagagggcttgcagt
gcctgcgcagggacatttggggaggacacatccgcactcccagctcctggtggcgggggg
tcaggtggagaccctacctga

KEGG   Homo sapiens (human): 5142Help
Entry
5142              CDS       T01001                                 

Gene name
PDE4B, DPDE4, PDEIVB
Definition
(RefSeq) phosphodiesterase 4B
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04024  cAMP signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429 D11630
Apremilast: D08860
Arofylline: D02985
Bemoradan: D03075
Bucladesine (DG00230): D01238 D07546
Caffeine (DG00974): D00528 D01453 D07603
Choline theophyllinate: D02017
Cilomilast: D01704
Cipamfylline: D03516
Crisaborole: D10873
Difamilast: D11314
Diprophylline: D00691
Drotaverine (DG00044): D07088 D07879
Enprofylline: D04006
Etazolate hydrochloride: D02655
Filaminast: D04185
Flavoxate (DG00477): D00718 D07961
Ibudilast: D01385
Lotamilast: D11305
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218 D07425 D07439
Piclamilast: D05474
Prinoxodan: D05612
Propentofylline: D01630
Proxyphylline: D01771
Roflumilast: D05744
Rolipram: D01783
Theophylline (DG01061): D00371 D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Tofimilast: D09020
Trapidil: D01220
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5142 (PDE4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    5142 (PDE4B)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    5142 (PDE4B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5142 (PDE4B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     5142 (PDE4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I PDE4_UCR
Motif
Other DBs
NCBI-GeneID: 5142
NCBI-ProteinID: NP_001032418
OMIM: 600127
HGNC: 8781
Ensembl: ENSG00000184588
Vega: OTTHUMG00000009088
Pharos: Q07343(Tclin)
UniProt: Q07343 X5DNX5
LinkDB All DBs
Structure
PDB: 

Position
1p31.3
AA seq 736 aa AA seqDB search
MKKSRSVMTVMADDNVKDYFECSLSKSYSSSSNTLGIDLWRGRRCCSGNLQLPPLSQRQS
ERARTPEGDGISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSAGLVL
HATFPGHSQRRESFLYRSDSDYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRSVR
NNFTILTNLHGTSNKRSPAASQPPVSRVNPQEESYQKLAMETLEELDWCLDQLETIQTYR
SVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKK
KQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSH
NRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHV
LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHL
AVGFKLLQEEHCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTS
SGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEI
SPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQSP
SPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLG
ETDIDIATEDKSPVDT
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaagcaggagtgtgatgacggtgatggctgatgataatgttaaagattatttt
gaatgtagcttgagtaaatcctacagttcttccagtaacacacttgggatcgacctctgg
agagggagaaggtgttgctcaggaaacttacagttaccaccactgtctcaaagacagagt
gaaagggcaaggactcctgagggagatggtatttccaggccgaccacactgcctttgaca
acgcttccaagcattgctattacaactgtaagccaggagtgctttgatgtggaaaatggc
ccttccccaggtcggagtccactggatccccaggccagctcttccgctgggctggtactt
cacgccacctttcctgggcacagccagcgcagagagtcatttctctacagatcagacagc
gactatgacttgtcaccaaaggcgatgtcgagaaactcttctcttccaagcgagcaacac
ggcgatgacttgattgtaactccttttgcccaggtccttgccagcttgcgaagtgtgaga
aacaacttcactatactgacaaaccttcatggtacatctaacaagaggtccccagctgct
agtcagcctcctgtctccagagtcaacccacaagaagaatcttatcaaaaattagcaatg
gaaacgctggaggaattagactggtgtttagaccagctagagaccatacagacctaccgg
tctgtcagtgagatggcttctaacaagttcaaaagaatgctgaaccgggagctgacacac
ctctcagagatgagccgatcagggaaccaggtgtctgaatacatttcaaatactttctta
gacaagcagaatgatgtggagatcccatctcctacccagaaagacagggagaaaaagaaa
aagcagcagctcatgacccagataagtggagtgaagaaattaatgcatagttcaagccta
aacaatacaagcatctcacgctttggagtcaacactgaaaatgaagatcacctggccaag
gagctggaagacctgaacaaatggggtcttaacatctttaatgtggctggatattctcac
aatagacccctaacatgcatcatgtatgctatattccaggaaagagacctcctaaagaca
ttcagaatctcatctgacacatttataacctacatgatgactttagaagaccattaccat
tctgacgtggcatatcacaacagcctgcacgctgctgatgtagcccagtcgacccatgtt
ctcctttctacaccagcattagacgctgtcttcacagatttggagatcctggctgccatt
tttgcagctgccatccatgacgttgatcatcctggagtctccaatcagtttctcatcaac
acaaattcagaacttgctttgatgtataatgatgaatctgtgttggaaaatcatcacctt
gctgtgggtttcaaactgctgcaagaagaacactgtgacatcttcatgaatctcaccaag
aagcagcgtcagacactcaggaagatggttattgacatggtgttagcaactgatatgtct
aaacatatgagcctgctggcagacctgaagacaatggtagaaacgaagaaagttacaagt
tcaggcgttcttctcctagacaactataccgatcgcattcaggtccttcgcaacatggta
cactgtgcagacctgagcaaccccaccaagtccttggaattgtatcggcaatggacagac
cgcatcatggaggaatttttccagcagggagacaaagagcgggagaggggaatggaaatt
agcccaatgtgtgataaacacacagcttctgtggaaaaatcccaggttggtttcatcgac
tacattgtccatccattgtgggagacatgggcagatttggtacagcctgatgctcaggac
attctcgataccttagaagataacaggaactggtatcagagcatgatacctcaaagtccc
tcaccaccactggacgagcagaacagggactgccagggtctgatggagaagtttcagttt
gaactgactctcgatgaggaagattctgaaggacctgagaaggagggagagggacacagc
tatttcagcagcacaaagacgctttgtgtgattgatccagaaaacagagattccctggga
gagactgacatagacattgcaacagaagacaagtcccccgtggatacataa

KEGG   Homo sapiens (human): 5143Help
Entry
5143              CDS       T01001                                 

Gene name
PDE4C, DPDE1, PDE21
Definition
(RefSeq) phosphodiesterase 4C
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04024  cAMP signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429 D11630
Apremilast: D08860
Arofylline: D02985
Bemoradan: D03075
Bucladesine (DG00230): D01238 D07546
Caffeine (DG00974): D00528 D01453 D07603
Choline theophyllinate: D02017
Cilomilast: D01704
Cipamfylline: D03516
Crisaborole: D10873
Difamilast: D11314
Diprophylline: D00691
Drotaverine (DG00044): D07088 D07879
Enprofylline: D04006
Etazolate hydrochloride: D02655
Filaminast: D04185
Flavoxate (DG00477): D00718 D07961
Ibudilast: D01385
Lotamilast: D11305
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218 D07425 D07439
Piclamilast: D05474
Prinoxodan: D05612
Propentofylline: D01630
Proxyphylline: D01771
Roflumilast: D05744
Rolipram: D01783
Theophylline (DG01061): D00371 D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Tofimilast: D09020
Trapidil: D01220
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5143 (PDE4C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    5143 (PDE4C)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    5143 (PDE4C)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5143 (PDE4C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     5143 (PDE4C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I PDE4_UCR
Motif
Other DBs
NCBI-GeneID: 5143
NCBI-ProteinID: NP_000914
OMIM: 600128
HGNC: 8782
Ensembl: ENSG00000105650
Vega: OTTHUMG00000183353
Pharos: Q08493(Tclin)
UniProt: Q08493 Q32MM7 O43849
LinkDB All DBs
Structure
PDB: 

Position
19p13.11
AA seq 712 aa AA seqDB search
MENLGVGEGAEACSRLSRSRGRHSMTRAPKHLWRQPRRPIRIQQRFYSDPDKSAGCRERD
LSPRPELRKSRLSWPVSSCRRFDLENGLSCGRRALDPQSSPGLGRIMQAPVPHSQRRESF
LYRSDSDYELSPKAMSRNSSVASDLHGEDMIVTPFAQVLASLRTVRSNVAALARQQCLGA
AKQGPVGNPSSSNQLPPAEDTGQKLALETLDELDWCLDQLETLQTRHSVGEMASNKFKRI
LNRELTHLSETSRSGNQVSEYISRTFLDQQTEVELPKVTAEEAPQPMSRISGLHGLCHSA
SLSSATVPRFGVQTDQEEQLAKELEDTNKWGLDVFKVAELSGNRPLTAIIFSIFQERDLL
KTFQIPADTLATYLLMLEGHYHANVAYHNSLHAADVAQSTHVLLATPALEAVFTDLEILA
ALFASAIHDVDHPGVSNQFLINTNSELALMYNDASVLENHHLAVGFKLLQAENCDIFQNL
SAKQRLSLRRMVIDMVLATDMSKHMNLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQN
LVHCADLSNPTKPLPLYRQWTDRIMAEFFQQGDRERESGLDISPMCDKHTASVEKSQVGF
IDYIAHPLWETWADLVHPDAQDLLDTLEDNREWYQSKIPRSPSDLTNPERDGPDRFQFEL
TLEEAEEEDEEEEEEGEETALAKEALELPDTELLSPEAGPDPGDLPLDNQRT
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atggagaacctgggggtcggcgaaggggcagaggcttgcagcaggttgagtcgctctcgc
ggccgccacagcatgaccagagccccgaagcacctgtggcggcaaccccggcgccccatc
cgcatccaacagcgcttctattcggatccggacaagtccgcgggctgccgcgagagggac
ctgagcccgcggccggagctcaggaagtcgcggctctcctggcccgtttcctcctgcagg
cgctttgacctggaaaatgggctctcgtgtgggaggagggccctggaccctcagtccagc
cctggcctgggccggattatgcaggctccagtcccgcacagccagcggcgcgagtccttc
ctgtaccgctcagatagcgactatgaactctcgcccaaggccatgtctcggaactcctct
gtggccagcgacctacatggagaggacatgattgtgacgccctttgcccaggtcctggcc
agtctgcggaccgttcggagcaacgtggcggcccttgcccgccagcaatgcctaggagca
gccaagcagggacccgtcggaaacccttcatccagcaatcagctccctcctgcagaggac
acggggcagaagctggcattggagacgctagacgagctggactggtgcctggatcagttg
gagacgctgcagacccggcactcggtgggggagatggcctccaacaagttcaagcggatc
ctgaaccgggagttgacccacctgtccgaaaccagccgctccgggaaccaggtgtccgag
tacatctcccggaccttcctggaccagcagaccgaggtggagctgcccaaggtgaccgct
gaggaggccccacagcccatgtcccggatcagtggcctacatgggctctgccacagtgcc
agcctctcctcagccactgtcccacgctttggggtccagactgaccaggaggagcaactg
gccaaggagctagaagacaccaacaagtggggacttgatgtgttcaaggtggcggagcta
agtgggaaccggcccctcacagctatcatattcagcatttttcaggagcgggacctgctg
aagacattccagatcccagcagacacactggccacctacctgctgatgctggaaggtcac
taccacgccaatgtggcctaccacaacagcctacatgccgccgacgtggcccagtccacg
catgtgctgctggctacgcccgccctcgaggctgtgttcacagacttggaaatcctggct
gccctctttgcaagcgccatccacgacgtggaccatcctggggtctccaaccagtttctg
attaacaccaactcagagctggcgcttatgtacaacgacgcctcggtgctggagaaccat
cacctggctgtgggcttcaagctgctgcaggcagagaactgcgatatcttccagaacctc
agcgccaagcagcgactgagtctgcgcaggatggtcattgacatggtgctggccacagac
atgtccaaacacatgaacctcctggccgacctcaagaccatggtggagaccaagaaggtg
acaagcctcggtgtcctcctcctggacaactattccgaccgaatccaggtcttgcagaac
ctggtgcactgtgctgatctgagcaaccccaccaagccgctgcccctgtaccgccagtgg
acggaccgcatcatggccgagttcttccagcagggagaccgcgagcgtgagtcgggcctg
gacatcagtcccatgtgtgacaagcatacggcctcagtggagaagtcccaggtgggtttc
attgactacattgctcacccactgtgggagacttgggctgacctggtccacccagatgca
caggacctgctggacacgctggaggacaatcgagagtggtaccagagcaagatcccccga
agtccctcagacctcaccaaccccgagcgggacgggcctgacagattccagtttgaactg
actctggaggaggcagaggaagaggatgaggaggaagaagaggagggggaagagacagct
ttagccaaagaggccttggagttgcctgacactgaactcctgtcccctgaagccggccca
gaccctggggacttacccctcgacaaccagaggacttag

KEGG   Homo sapiens (human): 5144Help
Entry
5144              CDS       T01001                                 

Gene name
PDE4D, ACRDYS2, DPDE3, HSPDE4D, PDE43, PDE4DN2, STRK1
Definition
(RefSeq) phosphodiesterase 4D
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04024  cAMP signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05032  Morphine addiction
Disease
H02211  Acrodysostosis
Drug target
Aminophylline (DG01062): D00227 D05429 D11630
Apremilast: D08860
Arofylline: D02985
Bemoradan: D03075
Bucladesine (DG00230): D01238 D07546
Caffeine (DG00974): D00528 D01453 D07603
Choline theophyllinate: D02017
Cilomilast: D01704
Cipamfylline: D03516
Crisaborole: D10873
Difamilast: D11314
Diprophylline: D00691
Drotaverine (DG00044): D07088 D07879
Enprofylline: D04006
Etazolate hydrochloride: D02655
Filaminast: D04185
Flavoxate (DG00477): D00718 D07961
Ibudilast: D01385
Lotamilast: D11305
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218 D07425 D07439
Piclamilast: D05474
Prinoxodan: D05612
Propentofylline: D01630
Proxyphylline: D01771
Roflumilast: D05744
Rolipram: D01783
Theophylline (DG01061): D00371 D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Tofimilast: D09020
Trapidil: D01220
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5144 (PDE4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    5144 (PDE4D)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    5144 (PDE4D)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5144 (PDE4D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     5144 (PDE4D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I PDE4_UCR
Motif
Other DBs
NCBI-GeneID: 5144
NCBI-ProteinID: NP_001098101
OMIM: 600129
HGNC: 8783
Ensembl: ENSG00000113448
Vega: OTTHUMG00000162218
Pharos: Q08499(Tclin)
UniProt: Q08499 A0A140VJR0
LinkDB All DBs
Structure
PDB: 

Position
5q11.2-q12.1
AA seq 809 aa AA seqDB search
MEAEGSSAPARAGSGEGSDSAGGATLKAPKHLWRHEQHHQYPLRQPQFRLLHPHHHLPPP
PPPSPQPQPQCPLQPPPPPPLPPPPPPPGAARGRYASSGATGRVRHRGYSDTERYLYCRA
MDRTSYAVETGHRPGLKKSRMSWPSSFQGLRRFDVDNGTSAGRSPLDPMTSPGSGLILQA
NFVHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVTPFAQVLASLRTVRNNF
AALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASETLEELDWCLDQLETLQTRHSV
SEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTFLDKQHEVEIPSPTQKEKEKKKRP
MSQISGVKKLMHSSSLTNSSIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPL
TVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLST
PALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGF
KLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVL
LLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMC
DKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAP
DDPEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPL
DEQVEEEAVGEEEESQPEACVIDDRSPDT
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagagggcagcagcgcgccggcccgggcgggcagcggagagggcagcgacagc
gccggcggggccacgctcaaagcccccaagcatctctggaggcacgagcagcaccaccag
tacccgctccggcagccccagttccgcctcctgcatccccatcaccacctgcccccgccg
ccgccaccctcgccccagccccagccccagtgtccgctacagccgccgccgccgcccccc
ctgccgccgcccccgccgccgcccggggctgcccgcggccgctacgcctcgagcggggcc
accggccgcgtccggcatcgcggctactcggacaccgagcgctacctgtactgtcgcgcc
atggaccgcacctcctacgcggtggagaccggccaccggcccggcctgaagaaatccagg
atgtcctggccctcctcgttccagggactcaggcgttttgatgtggacaatggcacatct
gcgggacggagtcccttggatcccatgaccagcccaggatccgggctaattctccaagca
aattttgtccacagtcaacgacgggagtccttcctgtatcgatccgacagcgattatgac
ctctctccaaagtctatgtcccggaactcctccattgccagtgatatacacggagatgac
ttgattgtgactccatttgctcaggtcttggccagtctgcgaactgtacgaaacaacttt
gctgcattaactaatttgcaagatcgagcacctagcaaaagatcacccatgtgcaaccaa
ccatccatcaacaaagccaccataacagaggaggcctaccagaaactggccagcgagacc
ctggaggagctggactggtgtctggaccagctagagaccctacagaccaggcactccgtc
agtgagatggcctccaacaagtttaaaaggatgcttaatcgggagctcacccatctctct
gaaatgagtcggtctggaaatcaagtgtcagagtttatatcaaacacattcttagataag
caacatgaagtggaaattccttctccaactcagaaggaaaaggagaaaaagaaaagacca
atgtctcagatcagtggagtcaagaaattgatgcacagctctagtctgactaattcaagt
atcccaaggtttggagttaaaactgaacaagaagatgtccttgccaaggaactagaagat
gtgaacaaatggggtcttcatgttttcagaatagcagagttgtctggtaaccggcccttg
actgttatcatgcacaccatttttcaggaacgggatttattaaaaacatttaaaattcca
gtagatactttaattacatatcttatgactctcgaagaccattaccatgctgatgtggcc
tatcacaacaatatccatgctgcagatgttgtccagtctactcatgtgctattatctaca
cctgctttggaggctgtgtttacagatttggagattcttgcagcaatttttgccagtgca
atacatgatgtagatcatcctggtgtgtccaatcaatttctgatcaatacaaactctgaa
cttgccttgatgtacaatgattcctcagtcttagagaaccatcatttggctgtgggcttt
aaattgcttcaggaagaaaactgtgacattttccagaatttgaccaaaaaacaaagacaa
tctttaaggaaaatggtcattgacatcgtacttgcaacagatatgtcaaaacacatgaat
ctactggctgatttgaagactatggttgaaactaagaaagtgacaagctctggagttctt
cttcttgataattattccgataggattcaggttcttcagaatatggtgcactgtgcagat
ctgagcaacccaacaaagcctctccagctgtaccgccagtggacggaccggataatggag
gagttcttccgccaaggagaccgagagagggaacgtggcatggagataagccccatgtgt
gacaagcacaatgcttccgtggaaaaatcacaggtgggcttcatagactatattgttcat
cccctctgggagacatgggcagacctcgtccaccctgacgcccaggatattttggacact
ttggaggacaatcgtgaatggtaccagagcacaatccctcagagcccctctcctgcacct
gatgacccagaggagggccggcagggtcaaactgagaaattccagtttgaactaacttta
gaggaagatggtgagtcagacacggaaaaggacagtggcagtcaagtggaagaagacact
agctgcagtgactccaagactctttgtactcaagactcagagtctactgaaattcccctt
gatgaacaggttgaagaggaggcagtaggggaagaagaggaaagccagcctgaagcctgt
gtcatagatgatcgttctcctgacacgtaa

DBGET integrated database retrieval system