KEGG   Homo sapiens (human): 10874
Entry
10874             CDS       T01001                                 

Gene name
NMU
Definition
(RefSeq) neuromedin U
  KO
K05249  neuromedin U
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    10874 (NMU)
SSDB
Motif
Pfam: NMU
Other DBs
NCBI-GeneID: 10874
NCBI-ProteinID: NP_006672
OMIM: 605103
HGNC: 7859
Ensembl: ENSG00000109255
Vega: OTTHUMG00000102161
Pharos: P48645(Tbio)
CPD: C15869
UniProt: P48645 A0A250SH36
LinkDB
Position
4q12
AA seq 174 aa
MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQQLQLWNEIDD
TCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVV
SSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI
NT seq 525 nt   +upstreamnt  +downstreamnt
atgctgcgaacagagagctgccgccccaggtcgcccgccggacaggtggccgcggcgtcc
ccgctcctgctgctgctgctgctgctcgcctggtgcgcgggcgcctgccgaggtgctcca
atattacctcaaggattacagcctgaacaacagctacagttgtggaatgagatagatgat
acttgttcgtcttttctgtccattgattctcagcctcaggcatccaacgcactggaggag
ctttgctttatgattatgggaatgctaccaaagcctcaggaacaagatgaaaaagataat
actaaaaggttcttatttcattattcgaagacacagaagttgggcaagtcaaatgttgtg
tcgtcagttgtgcatccgttgctgcagctcgttcctcacctgcatgagagaagaatgaag
agattcagagtggacgaagaattccaaagtccctttgcaagtcaaagtcgaggatatttt
ttattcaggccacggaatggaagaaggtcagcagggttcatttaa

DBGET integrated database retrieval system