KEGG   Homo sapiens (human): 10890
Entry
10890             CDS       T01001                                 

Gene name
RAB10
Definition
(RefSeq) RAB10, member RAS oncogene family
  KO
K07903  Ras-related protein Rab-10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    10890 (RAB10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    10890 (RAB10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10890 (RAB10)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10890 (RAB10)
   04031 GTP-binding proteins [BR:hsa04031]
    10890 (RAB10)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    10890 (RAB10)
 Protein recycling
  Rab GTPases and associated proteins
    10890 (RAB10)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   10890 (RAB10)
  Exosomal proteins of other body fluids (saliva and urine)
   10890 (RAB10)
  Exosomal proteins of colorectal cancer cells
   10890 (RAB10)
  Exosomal proteins of bladder cancer cells
   10890 (RAB10)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    10890 (RAB10)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB MMR_HSR1 AAA_7 TniB DUF3963
Other DBs
NCBI-GeneID: 10890
NCBI-ProteinID: NP_057215
OMIM: 612672
HGNC: 9759
Ensembl: ENSG00000084733
Vega: OTTHUMG00000094796
Pharos: P61026(Tbio)
UniProt: P61026
LinkDB
Structure
PDB: 
5SZJ 5LPN

Position
2p23.3
AA seq 200 aa
MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKL
QIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLL
GNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPN
SENVDISSGGGVTGWKSKCC
NT seq 603 nt   +upstreamnt  +downstreamnt
atggcgaagaagacgtacgacctgcttttcaagctgctcctgatcggggattccggagtg
gggaagacctgcgtcctttttcgtttttcggatgatgccttcaatactacctttatttcc
accataggaatagacttcaagatcaaaacagttgaattacaaggaaagaagatcaagcta
cagatatgggatacagcaggccaggagcgatttcacaccatcacaacctcctactacaga
ggcgcaatgggtatcatgctagtatatgacatcaccaatggtaaaagttttgaaaacatc
agcaaatggcttagaaacatagatgagcatgccaatgaagatgtggaaagaatgttacta
ggaaacaagtgtgatatggacgacaaaagagttgtacctaaaggaaaaggagaacagatt
gcaagggagcatggtattaggttttttgagactagtgcaaaagcaaatataaacatcgaa
aaggcgttcctcacgttagctgaagatatccttcgaaagacccctgtaaaagagcccaac
agtgaaaatgtagatatcagcagtggaggaggcgtgacaggctggaagagcaaatgctgc
tga

KEGG   Homo sapiens (human): 4218
Entry
4218              CDS       T01001                                 

Gene name
RAB8A, MEL, RAB8
Definition
(RefSeq) RAB8A, member RAS oncogene family
  KO
K07901  Ras-related protein Rab-8A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04144  Endocytosis
hsa04152  AMPK signaling pathway
hsa04530  Tight junction
hsa04972  Pancreatic secretion
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    4218 (RAB8A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4218 (RAB8A)
   04140 Autophagy - animal
    4218 (RAB8A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    4218 (RAB8A)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    4218 (RAB8A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    4218 (RAB8A)
   05022 Pathways of neurodegeneration - multiple diseases
    4218 (RAB8A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4218 (RAB8A)
   03036 Chromosome and associated proteins [BR:hsa03036]
    4218 (RAB8A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    4218 (RAB8A)
   04031 GTP-binding proteins [BR:hsa04031]
    4218 (RAB8A)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    4218 (RAB8A)
 Autophagy
  Other autophagy associated proteins
    4218 (RAB8A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    4218 (RAB8A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4218 (RAB8A)
  Exosomal proteins of other body fluids (saliva and urine)
   4218 (RAB8A)
  Exosomal proteins of colorectal cancer cells
   4218 (RAB8A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    4218 (RAB8A)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA SRPRB MMR_HSR1 GTP_EFTU Septin DUF3963 AAA_7 Phage_holin_6_1 AAA_16
Other DBs
NCBI-GeneID: 4218
NCBI-ProteinID: NP_005361
OMIM: 165040
HGNC: 7007
Ensembl: ENSG00000167461
Vega: OTTHUMG00000182238
Pharos: P61006(Tbio)
UniProt: P61006 A0A024R7I3
LinkDB
Structure
PDB: 

Position
19p13.11
AA seq 207 aa
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ
IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG
NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN
SPQGSNQGVKITPDQQKRSSFFRCVLL
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg
aagacctgtgtcctgttccgcttctccgaggacgccttcaactccacttttatctccacc
ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaaactgcag
atatgggacacagccggtcaggaacggtttcggacgatcacaacggcctactacaggggt
gcaatgggcatcatgctggtctacgacatcaccaacgagaagtccttcgacaacatccgg
aactggattcgcaacattgaggagcacgcctctgcagacgtcgaaaagatgatactcggg
aacaagtgtgatgtgaatgacaagagacaagtttccaaggaacggggagaaaagctggcc
ctcgactatggaatcaagttcatggagaccagcgcgaaggccaacatcaatgtggaaaat
gcatttttcactctcgccagagatatcaaagcaaaaatggacaaaaaattggaaggcaac
agcccccaggggagcaaccagggagtcaaaatcacaccggaccagcagaagaggagcagc
tttttccgatgtgttcttctgtga

KEGG   Homo sapiens (human): 51552
Entry
51552             CDS       T01001                                 

Gene name
RAB14, FBP, RAB-14
Definition
(RefSeq) RAB14, member RAS oncogene family
  KO
K07881  Ras-related protein Rab-14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    51552 (RAB14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51552 (RAB14)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    51552 (RAB14)
   04031 GTP-binding proteins [BR:hsa04031]
    51552 (RAB14)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    51552 (RAB14)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   51552 (RAB14)
  Exosomal proteins of other body fluids (saliva and urine)
   51552 (RAB14)
  Exosomal proteins of colorectal cancer cells
   51552 (RAB14)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    51552 (RAB14)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 Gtr1_RagA SRPRB DUF1863 Septin AAA AAA_22
Other DBs
NCBI-GeneID: 51552
NCBI-ProteinID: NP_057406
OMIM: 612673
HGNC: 16524
Ensembl: ENSG00000119396
Vega: OTTHUMG00000020582
Pharos: P61106(Tbio)
UniProt: P61106 A0A024R845
LinkDB
Structure
PDB: 
1Z0F 4DRZ 4D0G

Position
9q33.2
AA seq 215 aa
MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKI
KLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVII
LIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGS
LDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC
NT seq 648 nt   +upstreamnt  +downstreamnt
atggcaactgcaccatacaactactcttacatctttaaatatattattattggggacatg
ggagtaggaaaatcttgcttgcttcatcaatttacagaaaaaaaatttatggctgattgt
cctcacacaattggtgttgaatttggtacaagaataatcgaagttagtggccaaaaaata
aaactgcagatttgggatacggcaggacaggagcgatttagggctgttacacggagctac
tacagaggagctgcgggagctcttatggtctatgatatcactagaagaagtacatataac
cacttaagcagctggttgacagatgcaaggaatctcaccaatccaaatactgtaataatt
ctcataggaaataaagcagatttggaggcacagagagatgttacatatgaagaagccaaa
cagtttgctgaagaaaatggcttattgttcctcgaagcgagtgcaaaaacgggagagaat
gtagaagatgccttccttgaggctgccaagaaaatctatcagaacattcaggatggaagc
ttggatctgaatgctgctgagtctggtgtacaacacaaaccttcagccccgcagggaggc
cggctaaccagtgaaccccaaccccagagagaaggctgtggctgctag

KEGG   Homo sapiens (human): 5862
Entry
5862              CDS       T01001                                 

Gene name
RAB2A, LHX, RAB2
Definition
(RefSeq) RAB2A, member RAS oncogene family
  KO
K07877  Ras-related protein Rab-2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    5862 (RAB2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5862 (RAB2A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5862 (RAB2A)
   04031 GTP-binding proteins [BR:hsa04031]
    5862 (RAB2A)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    5862 (RAB2A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5862 (RAB2A)
  Exosomal proteins of other body fluids (saliva and urine)
   5862 (RAB2A)
  Exosomal proteins of colorectal cancer cells
   5862 (RAB2A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    5862 (RAB2A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase AAA_22 DAP3
Other DBs
NCBI-GeneID: 5862
NCBI-ProteinID: NP_002856
OMIM: 179509
HGNC: 9763
Ensembl: ENSG00000104388
Vega: OTTHUMG00000134298
Pharos: P61019(Tbio)
UniProt: P61019 A0A024R7V6
LinkDB
Structure
PDB: 
1Z0A

Position
8q12.1-q12.2
AA seq 212 aa
MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIW
DTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNK
SDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINN
EANGIKIGPQHAATNATHAGNQGGQQAGGGCC
NT seq 639 nt   +upstreamnt  +downstreamnt
atggcgtacgcctatctcttcaagtacatcataatcggcgacacaggtgttggtaaatca
tgcttattgctacagtttacagacaagaggtttcagccagtgcatgaccttactattggt
gtagagttcggtgctcgaatgataactattgatgggaaacagataaaacttcagatatgg
gatacggcagggcaagaatcctttcgttccatcacaaggtcgtattacagaggtgcagca
ggagctttactagtttacgatattacacggagagatacattcaaccacttgacaacctgg
ttagaagatgcccgccagcattccaattccaacatggtcattatgcttattggaaataaa
agtgatttagaatctagaagagaagtaaaaaaagaagaaggtgaagcttttgcacgagaa
catggactcatcttcatggaaacgtctgctaagactgcttccaatgtagaagaggcattt
attaatacagcaaaagaaatttatgaaaaaattcaagaaggagtctttgacattaataat
gaggcaaatggcattaaaattggccctcagcatgctgctaccaatgcaacacatgcaggc
aatcagggaggacagcaggctgggggcggctgctgttga

KEGG   Homo sapiens (human): 9230
Entry
9230              CDS       T01001                                 

Gene name
RAB11B, H-YPT3, NDAGSCW
Definition
(RefSeq) RAB11B, member RAS oncogene family
  KO
K07905  Ras-related protein Rab-11B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04152  AMPK signaling pathway
hsa04962  Vasopressin-regulated water reabsorption
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    9230 (RAB11B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9230 (RAB11B)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    9230 (RAB11B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    9230 (RAB11B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9230 (RAB11B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    9230 (RAB11B)
   04031 GTP-binding proteins [BR:hsa04031]
    9230 (RAB11B)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    9230 (RAB11B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   9230 (RAB11B)
  Exosomal proteins of other body fluids (saliva and urine)
   9230 (RAB11B)
  Exosomal proteins of colorectal cancer cells
   9230 (RAB11B)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    9230 (RAB11B)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase AAA_22 GTP_EFTU AAA_16 PduV-EutP FeoB_N ABC_tran Gtr1_RagA NTPase_1 SRPRB TniB AAA_14 FAD-SLDH AAA_24 Ploopntkinase3 AAA_5 AAA_21
Other DBs
NCBI-GeneID: 9230
NCBI-ProteinID: NP_004209
OMIM: 604198
HGNC: 9761
Ensembl: ENSG00000185236
Vega: OTTHUMG00000182278
Pharos: Q15907(Tbio)
UniProt: Q15907
LinkDB
Structure
PDB: 
2F9L 2F9M 4OJK

Position
19p13.2
AA seq 218 aa
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ
IADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQNL
NT seq 657 nt   +upstreamnt  +downstreamnt
atggggacccgggacgacgagtacgactacctattcaaagtggtgctcatcggggactca
ggcgtgggcaagagcaacctgctgtcgcgcttcacccgcaacgagttcaacctggagagc
aagagcaccatcggcgtggagttcgccacccgcagcatccaggtggacggcaagaccatc
aaggcgcagatctgggacaccgctggccaggagcgctaccgcgccatcacctccgcgtac
taccgtggtgcagtgggcgccctgctggtgtacgacatcgccaagcacctgacctatgag
aacgtggagcgctggctgaaggagctgcgggaccacgcagacagcaacatcgtcatcatg
ctggtgggcaacaagagtgacctgcgccacctgcgggctgtgcccactgacgaggcccgc
gccttcgcagaaaagaacaacttgtccttcatcgagacctcagccttggattccactaac
gtagaggaagcattcaagaacatcctcacagagatctaccgcatcgtgtcacagaaacag
atcgcagaccgcgctgcccacgacgagtccccggggaacaacgtggtggacatcagcgtg
ccgcccaccacggacggacagaagcccaacaagctgcagtgctgccagaacctgtga

DBGET integrated database retrieval system