KEGG   Homo sapiens (human): 10901
Entry
10901             CDS       T01001                                 

Gene name
DHRS4, CR, NRDR, PHCR, PSCD, SCAD-SRL, SDR-SRL, SDR25C1, SDR25C2
Definition
(RefSeq) dehydrogenase/reductase 4
  KO
K11147  dehydrogenase/reductase SDR family member 4 [EC:1.1.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    10901 (DHRS4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    10901 (DHRS4)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.-  Acting on the CH-OH group of donors
    1.1.-.-  
     10901 (DHRS4)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR DUF1776 F420_oxidored DFP YjeF_N DUF5037
Other DBs
NCBI-GeneID: 10901
NCBI-ProteinID: NP_066284
OMIM: 611596
HGNC: 16985
Ensembl: ENSG00000157326
Vega: OTTHUMG00000028777
Pharos: Q9BTZ2(Tbio)
UniProt: Q9BTZ2
LinkDB
Structure
PDB: 
3O4R

Position
14q11.2
AA seq 278 aa
MHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVV
VSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVN
PFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFS
PYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIR
RLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL
NT seq 837 nt   +upstreamnt  +downstreamnt
atgcacaaggcggggctgctaggcctctgtgcccgggcttggaattcggtgcggatggcc
agctccgggatgacccgccgggacccgctcgcaaataaggtggccctggtaacggcctcc
accgacgggatcggcttcgccatcgcccggcgtttggcccaggacggggcccatgtggtc
gtcagcagccggaagcagcagaatgtggaccaggcggtggccacgctgcagggggagggg
ctgagcgtgacgggcaccgtgtgccatgtggggaaggcggaggaccgggagcggctggtg
gccacggctgtgaagcttcatggaggtatcgatatcctagtctccaatgctgctgtcaac
cctttctttggaagcataatggatgtcactgaggaggtgtgggacaagactctggacatt
aatgtgaaggccccagccctgatgacaaaggcagtggtgccagaaatggagaaacgagga
ggcggctcagtggtgatcgtgtcttccatagcagccttcagtccatctcctggcttcagt
ccttacaatgtcagtaaaacagccttgctgggcctgaccaagaccctggccatagagctg
gccccaaggaacattagggtgaactgcctagcacctggacttatcaagactagcttcagc
aggatgctctggatggacaaggaaaaagaggaaagcatgaaagaaaccctgcggataaga
aggttaggcgagccagaggattgtgctggcatcgtgtctttcctgtgctctgaagatgcc
agctacatcactggggaaacagtggtggtgggtggaggaaccccgtcccgcctctga

KEGG   Homo sapiens (human): 728635
Entry
728635            CDS       T01001                                 

Gene name
DHRS4L1, SDR25C4
Definition
(RefSeq) dehydrogenase/reductase 4 like 1
  KO
K11147  dehydrogenase/reductase SDR family member 4 [EC:1.1.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    728635 (DHRS4L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    728635 (DHRS4L1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.-  Acting on the CH-OH group of donors
    1.1.-.-  
     728635 (DHRS4L1)
SSDB
Motif
Pfam: adh_short_C2 adh_short
Other DBs
NCBI-GeneID: 728635
NCBI-ProteinID: NP_001264793
OMIM: 615195
HGNC: 19732
LinkDB
Position
14q11.2
AA seq 150 aa
MTGTVCHVGKMKDWERLVATVSCREMGTEPGGGKGSQPEPPSLLSWTALGFSPYNVSKTA
LLGLNKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDS
LGIVSFLCSEDASYLTGETVMVGGGTPSRL
NT seq 453 nt   +upstreamnt  +downstreamnt
atgacgggcactgtgtgccatgtggggaagatgaaggactgggagcggctggtggccaca
gtgagctgcagggaaatgggcacagagccaggaggtggaaaagggagccagcctgagcct
ccttccctgctttcctggacagcattgggcttcagtccttacaatgtcagtaaaacagcc
ttgctgggcctcaacaagaccttggccatagagctggccccaaggaacattagggtgaac
tgcctagcacctggacttatcaagactagcttcagcaggatgctctggatggacaaggaa
aaagaggaaagcatgaaagaaaccctgcggataagaaggttaggcgagccagaggattct
cttggcatcgtgtctttcctgtgctctgaagatgccagctacctcactggggaaacagtg
atggtgggtggaggaaccccgtcccgcctctga

DBGET integrated database retrieval system