KEGG   Homo sapiens (human): 10919
Entry
10919             CDS       T01001                                 

Gene name
EHMT2, BAT8, C6orf30, G9A, GAT8, KMT1C, NG36
Definition
(RefSeq) euchromatic histone lysine methyltransferase 2
  KO
K11420  [histone H3]-lysine9 N-trimethyltransferase EHMT [EC:2.1.1.355]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00310  Lysine degradation
hsa01100  Metabolic pathways
hsa04211  Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    10919 (EHMT2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    10919 (EHMT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10919 (EHMT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.355  [histone H3]-lysine9 N-trimethyltransferase
     10919 (EHMT2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     10919 (EHMT2)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3 SET Pre-SET CDC45 Paf1 RNA_pol_3_Rpc31 Nop14 Sporozoite_P67 XRCC4
Other DBs
NCBI-GeneID: 10919
NCBI-ProteinID: NP_006700
OMIM: 604599
HGNC: 14129
Ensembl: ENSG00000204371
Vega: OTTHUMG00000031180
Pharos: Q96KQ7(Tchem)
UniProt: Q96KQ7 A0A024RCN9
LinkDB
Structure
PDB: 

Position
6p21.33
AA seq 1210 aa
MAAAAGAAAAAAAEGEAPAEMGALLLEKETRGATERVHGSLGDTPRSEETLPKATPDSLE
PAGPSSPASVTVTVGDEGADTPVGATPLIGDESENLEGDGDLRGGRILLGHATKSFPSSP
SKGGSCPSRAKMSMTGAGKSPPSVQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKV
HRARKTMSKPGNGQPPVPEKRPPEIQHFRMSDDVHSLGKVTSDLAKRRKLNSGGGLSEEL
GSARRSGEVTLTKGDPGSLEEWETVVGDDFSLYYDSYSVDERVDSDSKSEVEALTEQLSE
EEEEEEEEEEEEEEEEEEEEEEEDEESGNQSDRSGSSGRRKAKKKWRKDSPWVKPSRKRR
KREPPRAKEPRGVNGVGSSGPSEYMEVPLGSLELPSEGTLSPNHAGVSNDTSSLETERGF
EELPLCSCRMEAPKIDRISERAGHKCMATESVDGELSGCNAAILKRETMRPSSRVALMVL
CETHRARMVKHHCCPGCGYFCTAGTFLECHPDFRVAHRFHKACVSQLNGMVFCPHCGEDA
SEAQEVTIPRGDGVTPPAGTAAPAPPPLSQDVPGRADTSQPSARMRGHGEPRRPPCDPLA
DTIDSSGPSLTLPNGGCLSAVGLPLGPGREALEKALVIQESERRKKLRFHPRQLYLSVKQ
GELQKVILMLLDNLDPNFQSDQQSKRTPLHAAAQKGSVEICHVLLQAGANINAVDKQQRT
PLMEAVVNNHLEVARYMVQRGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNA
QDSGGWTPIIWAAEHKHIEVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNA
RCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGANPELRNKEGDTAWDLTPERSDVWFA
LQLNRKLRLGVGNRAIRTEKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETS
TMNIDRNITHLQHCTCVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQA
CSCWRNCKNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVR
EDDSYLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFS
SRDIRTGEELGFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLARLDPHPELLP
ELGSLPPVNT
NT seq 3633 nt   +upstreamnt  +downstreamnt
atggcggcggcggcgggagctgcagcggcggcggccgccgagggggaggcccccgctgag
atgggggcgctgctgctggagaaggaaaccagaggagccaccgagagagttcatggctct
ttgggggacacccctcgtagtgaagaaaccctgcccaaggccacccccgactccctggag
cctgctggcccctcatctccagcctctgtcactgtcactgttggtgatgagggggctgac
acccctgtaggggctacaccactcattggggatgaatctgagaatcttgagggagatggg
gacctccgtgggggccggatcctgctgggccatgccacaaagtcattcccctcttccccc
agcaaggggggttcctgtcctagccgggccaagatgtcaatgacaggggcgggaaaatca
cctccatctgtccagagtttggctatgaggctactgagtatgccaggagcccagggagct
gcagcagcagggtctgaaccccctccagccaccacgagcccagagggacagcccaaggtc
caccgagcccgcaaaaccatgtccaaaccaggaaatggacagcccccggtccctgagaag
cggccccctgaaatacagcatttccgcatgagtgatgatgtccactcactgggaaaggtg
acctcagatctggccaaaaggaggaagctgaactcaggaggtggcctgtcagaggagtta
ggttctgcccggcgttcaggagaagtgaccctgacgaaaggggaccccgggtccctggag
gagtgggagacggtggtgggtgatgacttcagtctctactatgattcctactctgtggat
gagcgcgtggactccgacagcaagtctgaagttgaagctctaactgaacaactaagtgaa
gaggaggaggaggaagaggaggaagaagaagaagaggaagaggaggaggaagaggaagaa
gaagaggaagatgaggagtcagggaatcagtcagataggagtggttccagtggccggcgc
aaggccaagaagaaatggcgaaaagacagcccatgggtgaagccgtctcggaaacggcgc
aagcgggagcctccgcgggccaaggagccacgaggagtgaatggtgtgggctcctcaggc
cccagtgagtacatggaggtccctctggggtccctggagctgcccagcgaggggaccctc
tcccccaaccacgctggggtgtccaatgacacatcttcgctggagacagagcgagggttt
gaggagttgcccctgtgcagctgccgcatggaggcacccaagattgaccgcatcagcgag
agggcggggcacaagtgcatggccactgagagtgtggacggagagctgtcaggctgcaat
gccgccatcctcaagcgggagaccatgaggccatccagccgtgtggccctgatggtgctc
tgtgagacccaccgcgcccgcatggtcaaacaccactgctgcccgggctgcggctacttc
tgcacggcgggcaccttcctggagtgccaccctgacttccgtgtggcccaccgcttccac
aaggcctgtgtgtctcagctgaatgggatggtcttctgtccccactgtggggaggatgct
tctgaagctcaagaggtgaccatcccccggggtgacggggtgaccccaccggccggcact
gcagctcctgcacccccacccctgtcccaggatgtccccgggagagcagacacttctcag
cccagtgcccggatgcgagggcatggggaaccccggcgcccgccctgcgatcccctggct
gacaccattgacagctcagggccctccctgaccctgcccaatgggggctgcctttcagcc
gtggggctgccactggggccaggccgggaggccctggaaaaggccctggtcatccaggag
tcagagaggcggaagaagctccgtttccaccctcggcagttgtacctgtccgtgaagcag
ggcgagctgcagaaggtgatcctgatgctgttggacaacctggaccccaacttccagagc
gaccagcagagcaagcgcacgcccctgcatgcagccgcccagaagggctccgtggagatc
tgccatgtgctgctgcaggctggagccaacataaatgcagtggacaaacagcagcggacg
ccactgatggaggccgtggtgaacaaccacctggaggtagcccgttacatggtgcagcgt
ggtggctgtgtctatagcaaggaggaggacggttccacctgcctccaccacgcagccaaa
atcgggaacttggagatggtcagcctgctgctgagcacaggacaggtggacgtcaacgcc
caggacagtggggggtggacgcccatcatctgggctgcagagcacaagcacatcgaggtg
atccgcatgctactgacgcggggcgccgacgtcaccctcactgacaacgaggagaacatc
tgcctgcactgggcctccttcacgggcagcgccgccatcgccgaagtccttctgaatgcg
cgctgtgacctccatgctgtcaactaccatggggacacccccctgcacatcgcagctcgg
gagagctaccatgactgcgtgctgttattcctgtcacgtggggccaaccctgagctgcgg
aacaaagagggggacacagcatgggacctgactcccgagcgctccgacgtgtggtttgcg
cttcaactcaaccgcaagctccgacttggggtgggaaatcgggccatccgcacagagaag
atcatctgccgggacgtggctcggggctatgagaacgtgcccattccctgtgtcaacggt
gtggatggggagccctgccctgaggattacaagtacatctcagagaactgcgagacgtcc
accatgaacatcgatcgcaacatcacccacctgcagcactgcacgtgtgtggacgactgc
tctagctccaactgcctgtgcggccagctcagcatccggtgctggtatgacaaggatggg
cgattgctccaggaatttaacaagattgagcctccgctgattttcgagtgtaaccaggcg
tgctcatgctggagaaactgcaagaaccgggtcgtacagagtggcatcaaggtgcggcta
cagctctaccgaacagccaagatgggctggggggtccgcgccctgcagaccatcccacag
gggaccttcatctgcgagtatgtcggggagctgatctctgatgctgaggctgatgtgaga
gaggatgattcttacctcttcgacttagacaacaaggatggagaggtgtactgcatagat
gcccgttactatggcaacatcagccgcttcatcaaccacctgtgtgaccccaacatcatt
cccgtccgggtcttcatgctgcaccaagacctgcgatttccacgcatcgccttcttcagt
tcccgagacatccggactggggaggagctagggtttgactatggcgaccgcttctgggac
atcaaaagcaaatatttcacctgccaatgtggctctgagaagtgcaagcactcagccgaa
gccattgccctggagcagagccgtctggcccgcctggacccacaccctgagctgctgccc
gagctcggctccctgccccctgtcaacacatga

KEGG   Homo sapiens (human): 79813
Entry
79813             CDS       T01001                                 

Gene name
EHMT1, EHMT1-IT1, EUHMTASE1, Eu-HMTase1, FP13812, GLP, GLP1, KLEFS1, KMT1D
Definition
(RefSeq) euchromatic histone lysine methyltransferase 1
  KO
K11420  [histone H3]-lysine9 N-trimethyltransferase EHMT [EC:2.1.1.355]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00310  Lysine degradation
hsa01100  Metabolic pathways
hsa04211  Longevity regulating pathway
Disease
H00907  Kleefstra syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    79813 (EHMT1)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    79813 (EHMT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    79813 (EHMT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.355  [histone H3]-lysine9 N-trimethyltransferase
     79813 (EHMT1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     79813 (EHMT1)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_3 Ank_5 Ank SET Pre-SET
Other DBs
NCBI-GeneID: 79813
NCBI-ProteinID: NP_079033
OMIM: 607001
HGNC: 24650
Ensembl: ENSG00000181090
Vega: OTTHUMG00000020995
Pharos: Q9H9B1(Tchem)
UniProt: Q9H9B1
LinkDB
Structure
PDB: 

Position
9q34.3
AA seq 1298 aa
MAAADAEAVPARGEPQQDCCVKTELLGEETPMAADEGSAEKQAGEAHMAADGETNGSCEN
SDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADDFVQTSVI
GSNGYILNKPALQAQPLRTTSTLASSLPGHAAKTLPGGAGKGRTPSAFPQTPAAPPATLG
EGSADTEDRKLPAPGADVKVHRARKTMPKSVVGLHAASKDPREVREARDHKEPKEEINKN
ISDFGRQQLLPPFPSLHQSLPQNQCYMATTKSQTACLPFVLAAAVSRKKKRRMGTYSLVP
KKKTKVLKQRTVIEMFKSITHSTVGSKGEKDLGASSLHVNGESLEMDSDEDDSEELEEDD
GHGAEQAAAFPTEDSRTSKESMSEADRAQKMDGESEEEQESVDTGEEEEGGDESDLSSES
SIKKKFLKRKGKTDSPWIKPARKRRRRSRKKPSGALGSESYKSSAGSAEQTAPGDSTGYM
EVSLDSLDLRVKGILSSQAEGLANGPDVLETDGLQEVPLCSCRMETPKSREITTLANNQC
MATESVDHELGRCTNSVVKYELMRPSNKAPLLVLCEDHRGRMVKHQCCPGCGYFCTAGNF
MECQPESSISHRFHKDCASRVNNASYCPHCGEESSKAKEVTIAKADTTSTVTPVPGQEKG
SALEGRADTTTGSAAGPPLSEDDKLQGAASHVPEGFDPTGPAGLGRPTPGLSQGPGKETL
ESALIALDSEKPKKLRFHPKQLYFSARQGELQKVLLMLVDGIDPNFKMEHQNKRSPLHAA
AEAGHVDICHMLVQAGANIDTCSEDQRTPLMEAAENNHLEAVKYLIKAGALVDPKDAEGS
TCLHLAAKKGHYEVVQYLLSNGQMDVNCQDDGGWTPMIWATEYKHVDLVKLLLSKGSDIN
IRDNEENICLHWAAFSGCVDIAEILLAAKCDLHAVNIHGDSPLHIAARENRYDCVVLFLS
RDSDVTLKNKEGETPLQCASLNSQVWSALQMSKALQDSAPDRPSPVERIVSRDIARGYER
IPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSM
RCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGV
RSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSRFIN
HHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGS
PKCRHSSAALAQRQASAAQEAQEDGLPDTSSAAAADPL
NT seq 3897 nt   +upstreamnt  +downstreamnt
atggccgccgccgatgccgaggcagttccggcgaggggggagcctcagcaggattgctgt
gtgaaaaccgagctgctgggagaagagacacctatggctgccgatgaaggctcagcagag
aaacaggcaggagaggcccacatggctgcggacggtgagaccaatgggtcttgtgaaaac
agcgatgccagcagtcatgcaaatgctgcaaagcacactcaggacagcgcaagggtcaac
ccccaggatggcaccaacacactaactcggatagcggaaaatggggtttcagaaagagac
tcagaagcggcgaagcaaaaccacgtcactgccgacgactttgtgcagacttctgtcatc
ggcagcaacggatacatcttaaataagccggccctacaggcacagcccttgaggactacc
agcactctggcctcttcgctgcctggccatgctgcaaaaacccttcctggaggggctggc
aaaggcaggactccaagcgcttttccccagacgccagccgccccaccagccacccttggg
gaggggagtgctgacacagaggacaggaagctcccggcccctggcgccgacgtcaaggtc
cacagggcacgcaagaccatgccgaagtccgtcgtgggcctgcatgcagccagtaaagat
cccagagaagttcgagaagctagagatcataaggaaccaaaagaggagatcaacaaaaac
atttctgactttggacgacagcagcttttaccccccttcccatcccttcatcagtcgcta
cctcagaaccagtgctacatggccaccacaaaatcacagacagcttgcttgccttttgtt
ttagcagctgcagtatctcggaagaaaaaacgaagaatgggaacctatagcctggttcct
aagaaaaagaccaaagtattaaaacagaggacggtgattgagatgtttaagagcataact
cattccactgtgggttccaagggggagaaggacctgggcgccagcagcctgcacgtgaat
ggggagagcctggagatggactcggatgaggacgactcagaggagctcgaggaggacgac
ggccatggtgcagagcaggcggccgcgttccccacagaggacagcaggacttccaaggag
agcatgtcggaggctgatcgcgcccagaagatggacggggagtccgaggaggagcaggag
tccgtggacaccggggaggaggaggaaggcggtgacgagtctgacctgagttcggaatcc
agcattaagaagaaatttctcaagaggaaaggaaagaccgacagtccctggatcaagcca
gccaggaaaaggaggcggagaagtagaaagaagcccagcggtgccctcggttctgagtcg
tataagtcatctgcaggaagcgctgagcagacggcaccaggagacagcacagggtacatg
gaagtttctctggactccctggatctccgagtcaaaggaattctgtcttcacaagcagaa
gggttggccaacggtccagatgtgctggagacagacggcctccaggaagtgcctctctgc
agctgccggatggaaacaccgaagagtcgagagatcaccacactggccaacaaccagtgc
atggctacagagagcgtggaccatgaattgggccggtgcacaaacagcgtggtcaagtat
gagctgatgcgcccctccaacaaggccccgctcctcgtgctgtgtgaagaccaccggggc
cgcatggtgaagcaccagtgctgtcctggctgtggctacttctgcacagcgggtaatttt
atggagtgtcagcccgagagcagcatctctcaccgtttccacaaagactgtgcctctcga
gtcaataacgccagctattgtccccactgtggggaggagagctccaaggccaaagaggtg
acgatagctaaagcagacaccacctcgaccgtgacaccagtccccgggcaggagaagggc
tcggccctggagggcagggccgacaccacaacgggcagtgctgccgggccaccactctcg
gaggacgacaagctgcagggtgcagcctcccacgtgcccgagggctttgatccaacggga
cctgctgggcttgggaggccaactcccggcctttcccagggaccagggaaggaaaccttg
gagagcgctctcatcgccctcgactcggaaaaacccaagaagcttcgcttccacccaaag
cagctgtacttctccgccaggcaaggggagcttcagaaggtgctcctcatgctggtggac
ggaattgaccccaacttcaaaatggagcaccagaataagcgctctccactgcacgccgcg
gcagaggctggacacgtggacatctgccacatgctggttcaggcgggcgctaatattgac
acctgctcagaagaccagaggaccccgttgatggaagcagccgaaaacaaccatctggaa
gcagtgaagtacctcatcaaggctggggccctggtggatcccaaggacgcagagggctct
acgtgtttgcacctggctgccaagaaaggccactacgaagtggtccagtacctgctttca
aatggacagatggacgtcaactgtcaggatgacggaggctggacacccatgatctgggcc
acagagtacaagcacgtggacctcgtgaagctgctgctgtccaagggctctgacatcaac
atccgagacaacgaggagaacatttgcctgcactgggcggcgttctccggctgcgtggac
atagccgagatcctgctggctgccaagtgcgacctccacgccgtgaacatccacggagac
tcgccactgcacattgccgcccgggagaaccgctacgactgtgtcgtcctctttctttct
cgggattcagatgtcaccttaaagaacaaggaaggagagacgcccctgcagtgtgcgagc
ctcaactctcaggtgtggagcgctctgcagatgagcaaggctctgcaggactcggccccc
gacaggcccagccccgtggagaggatagtgagcagggacatcgctcgaggctacgagcgc
atccccatcccctgtgtcaacgccgtggacagcgagccatgccccagcaactacaagtac
gtctctcagaactgcgtgacgtcccccatgaacatcgacagaaatatcactcatctgcag
tactgcgtgtgcatcgacgactgctcctccagcaactgcatgtgcggccagctcagcatg
cgctgctggtacgacaaggatggccggctcctgccagagttcaacatggcggagcctccc
ttgatcttcgaatgcaaccacgcgtgctcctgctggaggaactgccgaaatcgcgtcgta
cagaatggtctcagggcaaggctgcagctctaccggacgcgggacatgggctggggcgtg
cggtccctgcaggacatcccaccaggcacctttgtctgcgagtatgttggggagctgatt
tcagactcagaagccgacgttcgagaggaagattcttacctctttgatctcgacaataag
gacggggaggtttactgcatcgacgcgcggttctacgggaacgtcagccggttcatcaac
caccactgcgagcccaacctggtgcccgtgcgcgtgttcatggcccaccaggacctgcgg
ttcccccggatcgccttcttcagcacccgcctgatcgaggccggcgagcagctcgggttt
gactatggagagcgcttctgggacatcaaaggcaagctcttcagctgccgctgcggctcc
cccaagtgccggcactcgagcgcggccctggcccagcgtcaggccagcgcggcccaggag
gcccaggaggacggcttgcccgacaccagctccgcggctgccgccgaccccctatga

DBGET integrated database retrieval system