KEGG   Homo sapiens (human): 10929Help
Entry
10929             CDS       T01001                                 

Gene name
SRSF8, DSM-1, SFRS2B, SRP46
Definition
(RefSeq) serine and arginine rich splicing factor 8
  KO
K12891  splicing factor, arginine/serine-rich 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex virus 1 infection
Network
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
  Element
N00586  Nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    10929 (SRSF8)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    10929 (SRSF8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10929 (SRSF8)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    10929 (SRSF8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_occluded
Motif
Other DBs
NCBI-GeneID: 10929
NCBI-ProteinID: NP_115285
OMIM: 603269
HGNC: 16988
Ensembl: ENSG00000263465
Vega: OTTHUMG00000188534
Pharos: Q9BRL6(Tdark)
UniProt: Q9BRL6 A0A024R3A8
LinkDB All DBs
Structure
PDB: 

Position
11q21
AA seq 282 aa AA seqDB search
MSCGRPPPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFV
RFHDRRDAQDAEAAMDGAELDGRELRVQVARYGRRDLPRSRQGEPRGRSRGGGYGRRSRS
YGRRSRSPRRRHRSRSRGPSCSRSRSRSRYRGSRYSRSPYSRSPYSRSRYSRSPYSRSRY
RESRYGGSHYSSSGYSNSRYSRYHSSRSHSKSGSSTSSRSASTSKSSSARRSKSSSVSRS
RSRSRSSSMTRSPPRVSKRKSKSRSRSKRPPKSPEEEGQMSS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcggccgcccccctcccgacgtggacggcatgatcaccctcaaggtggacaac
ctgacctaccgcacctctcccgacagcttgaggcgcgtgttcgagaagtacgggcgcgtg
ggcgacgtgtacatcccgcgggagccccacaccaaggcgccccggggcttcgctttcgtc
cgctttcacgaccggcgcgacgcccaagacgccgaggccgccatggacggggcggagctg
gacggacgcgagctgcgggtgcaggtggcgcgctatggccgccgggacctgccccgcagc
cgccagggagagccacgcggcaggtccagaggcggcggctacggacggcggagccgcagc
tacgggcggcggagccgcagccccaggcggcgacaccgcagccgatcccggggtcccagc
tgctccaggtcccgcagccgatctcgctataggggttctcgctatagccggtctccctac
agccgatctccttacagccggtcgcgctacagccgctctccctacagcagatctcgctac
agggaatctcgctacggcggatctcactacagctcatctggttacagtaactctcgctac
agccgatatcacagcagccggtctcactcgaagtctgggtcctccactagctctcgctct
gcatcaacctccaaatcgagctctgcgcgacgatccaagtcctcctcggtctccaggtct
cgctcgcggtccaggtcttcatctatgaccaggagtcctccccgggtatccaagaggaaa
tccaagtcaaggtcgcgatccaagaggccccccaagtctcctgaagaggaaggacagatg
tcctcttaa

KEGG   Homo sapiens (human): 6426Help
Entry
6426              CDS       T01001                                 

Gene name
SRSF1, ASF, SF2, SF2p33, SFRS1, SRp30a
Definition
(RefSeq) serine and arginine rich splicing factor 1
  KO
K12890  splicing factor, arginine/serine-rich 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa04657  IL-17 signaling pathway
hsa05168  Herpes simplex virus 1 infection
Network
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
  Element
N00586  Nuclear export of mRNA
N00587  HSV ICP27 to Nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6426 (SRSF1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6426 (SRSF1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    6426 (SRSF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6426 (SRSF1)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6426 (SRSF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_occluded RRM_3 RRM_7 Nup35_RRM_2 Corona_nucleoca DDE_Tnp_1 PRP38_assoc
Motif
Other DBs
NCBI-GeneID: 6426
NCBI-ProteinID: NP_008855
OMIM: 600812
HGNC: 10780
Ensembl: ENSG00000136450
Vega: OTTHUMG00000178781
Pharos: Q07955(Tbio)
UniProt: Q07955
LinkDB All DBs
Structure
PDB: 

Position
17q22
AA seq 248 aa AA seqDB search
MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVE
FEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSE
NRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKF
RSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPR
HSRSRSRT
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggaggtggtgtgattcgtggccccgcagggaacaacgattgccgcatctacgtg
ggtaacttacctccagacatccgaaccaaggacattgaggacgtgttctacaaatacggc
gctatccgcgacatcgacctcaagaatcgccgcgggggaccgcccttcgccttcgttgag
ttcgaggacccgcgagacgcggaagacgcggtgtatggtcgcgacggctatgattacgat
gggtaccgtctgcgggtggagtttcctcgaagcggccgtggaacaggccgaggcggcggc
gggggtggaggtggcggagctccccgaggtcgctatggccccccatccaggcggtctgaa
aacagagtggttgtctctggactgcctccaagtggaagttggcaggatttaaaggatcac
atgcgtgaagcaggtgatgtatgttatgctgatgtttaccgagatggcactggtgtcgtg
gagtttgtacggaaagaagatatgacctatgcagttcgaaaactggataacactaagttt
agatctcatgagggagaaactgcctacatccgggttaaagttgatgggcccagaagtcca
agttatggaagatctcgatctcgaagccgtagtcgtagcagaagccgtagcagaagcaac
agcaggagtcgcagttactccccaaggagaagcagaggatcaccacgctattctccccgt
catagcagatctcgctctcgtacataa

KEGG   Homo sapiens (human): 6427Help
Entry
6427              CDS       T01001                                 

Gene name
SRSF2, PR264, SC-35, SC35, SFRS2, SFRS2A, SRp30b
Definition
(RefSeq) serine and arginine rich splicing factor 2
  KO
K12891  splicing factor, arginine/serine-rich 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex virus 1 infection
Network
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
  Element
N00586  Nuclear export of mRNA
Disease
H01481  Myelodysplastic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6427 (SRSF2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    6427 (SRSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6427 (SRSF2)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6427 (SRSF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 Nup35_RRM_2 RRM_5 RRM_occluded
Motif
Other DBs
NCBI-GeneID: 6427
NCBI-ProteinID: NP_001182356
OMIM: 600813
HGNC: 10783
Ensembl: ENSG00000161547
Vega: OTTHUMG00000177547
Pharos: Q01130(Tbio)
UniProt: Q01130 A0A024R8U5 Q53FN0
LinkDB All DBs
Structure
PDB: 

Position
17q25.1
AA seq 221 aa AA seqDB search
MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFV
RFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRYGGGGYGRRSR
SPRRRRRSRSRSRSRSRSRSRSRYSRSKSRSRTRSRSRSTSKSRSARRSKSKSSSVSRSR
SRSRSRSRSRSPPPVSKRESKSRSRSKSPPKSPEEEGAVSS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagctacggccgcccccctcccgatgtggagggtatgacctccctcaaggtggacaac
ctgacctaccgcacctcgcccgacacgctgaggcgcgtcttcgagaagtacgggcgcgtc
ggcgacgtgtacatcccgcgggaccgctacaccaaggagtcccgcggcttcgccttcgtt
cgctttcacgacaagcgcgacgctgaggacgctatggatgccatggacggggccgtgctg
gacggccgcgagctgcgggtgcaaatggcgcgctacggccgccccccggactcacaccac
agccgccggggaccgccaccccgcaggtacgggggcggtggctacggacgccggagccgc
agccctaggcggcgtcgccgcagccgatcccggagtcggagccgttccaggtctcgcagc
cgatctcgctacagccgctcgaagtctcggtcccgcactcgttctcgatctcggtcgacc
tccaagtccagatccgcacgaaggtccaagtccaagtcctcgtcggtctccagatctcgt
tcgcggtccaggtcccggtctcggtccaggagtcctcccccagtgtccaagagggaatcc
aaatccaggtcgcgatcgaagagtccccccaagtctcctgaagaggaaggagcggtgtcc
tcttaa

KEGG   Homo sapiens (human): 6428Help
Entry
6428              CDS       T01001                                 

Gene name
SRSF3, SFRS3, SRp20
Definition
(RefSeq) serine and arginine rich splicing factor 3
  KO
K12892  splicing factor, arginine/serine-rich 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex virus 1 infection
Network
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
  Element
N00586  Nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6428 (SRSF3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    6428 (SRSF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6428 (SRSF3)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6428 (SRSF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_5 RRM_occluded
Motif
Other DBs
NCBI-GeneID: 6428
NCBI-ProteinID: NP_003008
OMIM: 603364
HGNC: 10785
Ensembl: ENSG00000112081
Vega: OTTHUMG00000014599
Pharos: P84103(Tbio)
UniProt: P84103 B2R6F3
LinkDB All DBs
Structure
PDB: 

Position
6p21.31-p21.2
AA seq 164 aa AA seqDB search
MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAA
DAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRS
FSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtgattcctgtccattggactgtaaggtttatgtaggcaatcttggaaacaat
ggcaacaagacggaattggaacgggcttttggctactatggaccactccgaagtgtgtgg
gttgctagaaacccacccggctttgcttttgttgaatttgaagatccccgagatgcagct
gatgcagtccgagagctagatggaagaacactatgtggctgccgtgtaagagtggaactg
tcgaatggtgaaaaaagaagtagaaatcgtggcccacctccctcttggggtcgtcgccct
cgagatgattatcgtaggaggagtcctccacctcgtcgcagatctccaagaaggagaagc
ttctctcgcagccggagcaggtccctttctagagataggagaagagagagatcgctgtct
cgggagagaaatcacaagccgtcccgatccttctctaggtctcgtagtcgatctaggtca
aatgaaaggaaatag

KEGG   Homo sapiens (human): 6429Help
Entry
6429              CDS       T01001                                 

Gene name
SRSF4, SFRS4, SRP75
Definition
(RefSeq) serine and arginine rich splicing factor 4
  KO
K12893  splicing factor, arginine/serine-rich 4/5/6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex virus 1 infection
Network
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
  Element
N00586  Nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6429 (SRSF4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    6429 (SRSF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6429 (SRSF4)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6429 (SRSF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_3 Nup35_RRM_2
Motif
Other DBs
NCBI-GeneID: 6429
NCBI-ProteinID: NP_005617
OMIM: 601940
HGNC: 10786
Ensembl: ENSG00000116350
Vega: OTTHUMG00000003663
Pharos: Q08170(Tbio)
UniProt: Q08170
LinkDB All DBs
Position
1p35.3
AA seq 494 aa AA seqDB search
MPRVYIGRLSYQARERDVERFFKGYGKILEVDLKNGYGFVEFDDLRDADDAVYELNGKDL
CGERVIVEHARGPRRDGSYGSGRSGYGYRRSGRDKYGPPTRTEYRLIVENLSSRCSWQDL
KDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVEDKPGSR
RRRSYSRSRSHSRSRSRSRHSRKSRSRSGSSKSSHSKSRSRSRSGSRSRSKSRSRSQSRS
RSKKEKSRSPSKEKSRSRSHSAGKSRSKSKDQAEEKIQNNDNVGKPKSRSPSRHKSKSKS
RSRSQERRVEEEKRGSVSRGRSQEKSLRQSRSRSRSKGGSRSRSRSRSKSKDKRKGRKRS
REESRSRSRSRSKSERSRKRGSKRDSKAGSSKKKKKEDTDRSQSRSPSRSVSKEREHAKS
ESSQREGRGESENAGTNQETRSRSRSNSKSKPNLPSESRSRSKSASKTRSRSKSRSRSAS
RSPSRSRSRSHSRS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgggtgtacatcggccgcctgagctaccaggcccgggagcgcgatgtggagcgc
ttctttaagggctacgggaagatcctggaggtggatctgaagaacggatatggttttgtg
gagtttgatgatctgcgtgatgcagatgatgctgtttatgaactgaatggcaaagacctt
tgtggtgagcgagtaattgttgagcatgcccgcggcccacggcgagatggcagttacggt
tctggacgcagtggatatggttatagaagaagtggccgagataaatatggccctcctact
cgcacagagtacagacttattgtggagaatttgtcaagtcggtgcagctggcaagaccta
aaggattatatgcgtcaggcaggagaagtgacttatgcagatgctcacaagggacgcaaa
aatgaaggggtgattgaatttgtatcttattctgatatgaaaagagctttggaaaagttg
gatggaactgaagtcaatgggagaaaaatcagattagttgaagacaagccaggttccaga
cgacgccggtcctactccagaagccggagtcattcaaggtctcgctctcgaagcagacat
tcccgtaagagcagaagccgaagtggcagcagcaaaagcagtcattctaagagtagatct
cggtccaggtcgggctcccgctcccggagcaagagccggagccggagccagagtcggagc
cggagcaagaaagagaaaagcaggagccccagcaaggaaaagagccgcagccgcagccat
agcgctggcaagagccgcagcaagagcaaagaccaagctgaagagaagatccaaaacaat
gacaatgtcgggaaacccaagagccggagtcctagcaggcataaaagtaagagcaaaagt
cggagcaggagtcaggagaggagagtggaggaggagaagcgagggagtgtgagcaggggc
aggagccaggagaagagcctccgccagagtcggagccggagcaggagcaaagggggcagc
aggagccggagcaggagccgcagcaagagcaaggacaagaggaagggcaggaagagaagc
agagaggagagccgcagtcgcagtcgcagccgcagcaagagtgagaggagcagaaagcga
ggcagcaagcgagacagcaaggcgggcagcagcaagaagaagaagaaggaagacactgac
cgctcccagtccagatctccatcccgctccgtgtcaaaggagcgggaacatgccaagtct
gaatccagccagagggaaggtcgaggagagagtgagaatgctggcaccaatcaggagacc
cggtccaggtcgagatccaattccaaatcgaaaccaaaccttccatcagaatcacgctcc
agatcaaagtcagcttcaaaaacccgatctcggtccaagtctagatccaggtctgcttcc
agatcgccctcccgatctagatctaggtcccactcaaggtcctaa

KEGG   Homo sapiens (human): 6430Help
Entry
6430              CDS       T01001                                 

Gene name
SRSF5, HRS, SFRS5, SRP40
Definition
(RefSeq) serine and arginine rich splicing factor 5
  KO
K12893  splicing factor, arginine/serine-rich 4/5/6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex virus 1 infection
Network
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
  Element
N00586  Nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6430 (SRSF5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    6430 (SRSF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6430 (SRSF5)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6430 (SRSF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_3 Nup35_RRM_2 RRM_5
Motif
Other DBs
NCBI-GeneID: 6430
NCBI-ProteinID: NP_001034554
OMIM: 600914
HGNC: 10787
Ensembl: ENSG00000100650
Vega: OTTHUMG00000171235
Pharos: Q13243(Tbio)
UniProt: Q13243 A0A024R6D8
LinkDB All DBs
Position
14q24.1
AA seq 272 aa AA seqDB search
MSGCRVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGK
ELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVS
WQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYGDLKNAIEKLSGKEINGRKIKLIEGS
KRHSRSRSRSRSRTRSSSRSRSRSRSRSRKSYSRSRSRSRSRSRSKSRSVSRSPVPEKSQ
KRGSSSRSKSPASVDRQRSRSRSRSRSVDSGN
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagtggctgtcgggtattcatcgggagactaaatccagcggccagggagaaggacgtg
gaaagattcttcaagggatatggacggataagagatattgatctgaaaagaggctttggt
tttgtggaatttgaggatccaagggatgcagatgatgctgtgtatgagcttgatggaaaa
gaactctgtagtgaaagggttactattgaacatgctagggctcggtcacgaggtggaaga
ggtagaggacgatactctgaccgttttagtagtcgcagacctcgaaatgatagacgaaat
gctccacctgtaagaacagaaaatcgtcttatagttgagaatttatcctcaagagtcagc
tggcaggatctcaaagatttcatgagacaagctggggaagtaacgtttgcggatgcacac
cgacctaaattaaatgaaggggtggttgagtttgcctcttatggtgacttaaagaatgct
attgaaaaactttctggaaaggaaataaatgggagaaaaataaaattaattgaaggcagc
aaaaggcacagtaggtcaagaagcaggtctcgatcccggaccagaagttcctctaggtct
cgtagccgatcccgttcccgtagtcgcaaatcttacagccggtcaagaagcaggagcagg
agccggagccggagcaagtcccgttctgttagtaggtctcccgtgcctgagaagagccag
aaacgtggttcttcaagtagatctaagtctccagcatctgtggatcgccagaggtcccgg
tcccgatcaaggtccagatcagttgacagtggcaattaa

KEGG   Homo sapiens (human): 6431Help
Entry
6431              CDS       T01001                                 

Gene name
SRSF6, B52, HEL-S-91, SFRS6, SRP55
Definition
(RefSeq) serine and arginine rich splicing factor 6
  KO
K12893  splicing factor, arginine/serine-rich 4/5/6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex virus 1 infection
Network
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
  Element
N00586  Nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6431 (SRSF6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    6431 (SRSF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6431 (SRSF6)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6431 (SRSF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_3 RRM_occluded RRM_5 Nup35_RRM_2
Motif
Other DBs
NCBI-GeneID: 6431
NCBI-ProteinID: NP_006266
OMIM: 601944
HGNC: 10788
Ensembl: ENSG00000124193
Vega: OTTHUMG00000032502
Pharos: Q13247(Tbio)
UniProt: Q13247
LinkDB All DBs
Position
20q13.11
AA seq 344 aa AA seqDB search
MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKEL
CGERVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSR
CSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIE
DKPRTSHRRSYSGSRSRSRSRRRSRSRSRRSSRSRSRSISKSRSRSRSRSKGRSRSRSKG
RKSRSKSKSKPKSDRGSHSHSRSRSKDEYEKSRSRSRSRSPKENGKGDIKSKSRSRSQSR
SNSPLPVPPSKARSVSPPPKRATSRSRSRSRSKSRSRSRSSSRD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcgtctacataggacgcctgagctacaacgtccgggagaaggacatccagcgc
tttttcagtggctatggccgcctcctcgaagtagacctcaaaaatgggtacggcttcgtg
gagttcgaggactcccgcgacgccgacgacgccgtttacgagctgaacggcaaggagctc
tgcggcgagcgcgtgatcgtagagcacgcccggggcccgcgtcgcgatcgcgacggctac
agctacggaagccgcagtggtggaggtggatacagcagtcggagaacatctggcagagac
aaatacggaccacctgttcgtacagaatacaggcttattgtagaaaatctttctagtcgg
tgcagttggcaagatttaaaggattttatgcgacaagcaggtgaagtaacctatgcggat
gcccacaaggaacgaacaaatgagggtgtaattgagtttcgctcctactctgacatgaag
cgtgctttggacaaactggatggcacagaaataaatggcagaaatattaggcttattgaa
gataagccacgcacaagccataggcgatcttactctggaagcagatccaggtctcgatct
agaagacggtcacgaagtaggagtcgcaggagcagccgcagtagatctcgaagtatctca
aaaagtcgctcccgttccaggtcgcggagcaaaggtcgatcacgttctcgatcaaaaggc
aggaaatctagatcaaagagcaaatctaagcccaagtctgatcggggctcccattcacat
tctcgaagcagatctaaggatgagtatgagaaatctcgaagcaggtctcggtcccgatcc
cctaaagaaaatggaaagggtgatataaagtcaaaatccagatcaaggagccagtcccgt
tccaattcgccgctacctgttccaccctcaaaggcccgttctgtgtcccctccaccaaaa
agagctacttcaagatcccgttctagatctcgctcaaagtcaagatcaaggtccaggtcg
agttccagagattaa

KEGG   Homo sapiens (human): 6432Help
Entry
6432              CDS       T01001                                 

Gene name
SRSF7, 9G8, AAG3, SFRS7
Definition
(RefSeq) serine and arginine rich splicing factor 7
  KO
K12896  splicing factor, arginine/serine-rich 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex virus 1 infection
Network
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
  Element
N00586  Nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6432 (SRSF7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    6432 (SRSF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6432 (SRSF7)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6432 (SRSF7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 zf-CCHC RRM_5 zf-CCHC_3
Motif
Other DBs
NCBI-GeneID: 6432
NCBI-ProteinID: NP_001026854
OMIM: 600572
HGNC: 10789
Ensembl: ENSG00000115875
Vega: OTTHUMG00000102076
Pharos: Q16629(Tbio)
UniProt: Q16629
LinkDB All DBs
Structure
PDB: 

Position
2p22.1
AA seq 238 aa AA seqDB search
MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDA
EDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCH
RYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSR
SGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgttacgggcggtacggaggagaaaccaaggtgtatgttggtaacctgggaact
ggcgctggcaaaggagagttagaaagggctttcagttattatggtcctttaagaactgta
tggattgcgagaaatcctccaggatttgcctttgtggaattcgaagatcctagagatgca
gaagatgcagtacgaggactggatggaaaggtgatttgtggctcccgagtgagggttgaa
ctatcgacaggcatgcctcggagatcacgttttgatagaccacctgcccgacgtcccttt
gatccaaatgatagatgctatgagtgtggcgaaaagggacattatgcttatgattgtcat
cgttacagccggcgaagaagaagcaggtcacggtctagatcacattctcgatccagagga
aggcgatactctcgctcacgcagcaggagcaggggacgaaggtcaaggtcagcatctcct
cgacgatcaagatctatctctcttcgtagatcaagatcagcttcactcagaagatctagg
tctggttctataaaaggatcgaggtatttccaatccccgtcgaggtcaagatcaagatcc
aggtctatttcacgaccaagaagcagccgatcaaagtccagatctccatctccaaaaaga
agtcgttccccatcaggaagtcctcgcagaagtgcaagtcctgaaagaatggactga

KEGG   Homo sapiens (human): 8683Help
Entry
8683              CDS       T01001                                 

Gene name
SRSF9, SFRS9, SRp30c
Definition
(RefSeq) serine and arginine rich splicing factor 9
  KO
K21123  splicing factor, arginine/serine-rich 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex virus 1 infection
Network
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
  Element
N00586  Nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    8683 (SRSF9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    8683 (SRSF9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    8683 (SRSF9)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    8683 (SRSF9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 Nup35_RRM_2 RRM_3 RRM_7 RRM_occluded
Motif
Other DBs
NCBI-GeneID: 8683
NCBI-ProteinID: NP_003760
OMIM: 601943
HGNC: 10791
Ensembl: ENSG00000111786
Vega: OTTHUMG00000047790
Pharos: Q13242(Tbio)
UniProt: Q13242
LinkDB All DBs
Position
12q24.31
AA seq 221 aa AA seqDB search
MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFE
DPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPP
SGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYI
RVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggctgggcggacgagcgcggcggcgagggcgacgggcgcatctacgtggggaac
cttccgaccgacgtgcgcgagaaggacttggaggacctgttctacaagtacggccgcatc
cgcgagatcgagctcaagaaccggcacggcctcgtgcccttcgccttcgtgcgcttcgag
gacccccgagatgcagaggatgctatttatggaagaaatggttatgattatggccagtgt
cggcttcgtgtggagttccccaggacttatggaggtcggggtgggtggccccgtggtggg
aggaatgggcctcctacaagaagatctgatttccgagttcttgtttcaggacttcctccg
tcaggcagctggcaggacctgaaggatcacatgcgagaagctggggatgtctgttatgct
gatgtgcagaaggatggagtggggatggtcgagtatctcagaaaagaagacatggaatat
gccctgcgtaaactggatgacaccaaattccgctctcatgagggtgaaacttcctacatc
cgagtttatcctgagagaagcaccagctatggctactcacggtctcggtctgggtcaagg
ggccgtgactctccataccaaagcaggggttccccacactacttctctcctttcaggccc
tactga

DBGET integrated database retrieval system