KEGG   Homo sapiens (human): 10938Help
Entry
10938             CDS       T01001                                 

Gene name
EHD1, H-PAST, HPAST1, PAST, PAST1
Definition
(RefSeq) EH domain containing 1
  KO
K12483  EH domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    10938 (EHD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10938 (EHD1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10938 (EHD1)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    10938 (EHD1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   10938 (EHD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF5600 EF-hand_4 EHD_N Dynamin_N MMR_HSR1 EF-hand_1 GTP_EFTU Roc Gtr1_RagA FeoB_N AAA_28 AAA_16 EF-hand_7 AIG1 TsaE EF-hand_6
Motif
Other DBs
NCBI-GeneID: 10938
NCBI-ProteinID: NP_001269373
OMIM: 605888
HGNC: 3242
Ensembl: ENSG00000110047
Vega: OTTHUMG00000066832
Pharos: Q9H4M9(Tbio)
UniProt: Q9H4M9 B2R5U3
LinkDB All DBs
Structure
PDB: 

Position
11q13.1
AA seq 534 aa AA seqDB search
MFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPM
VLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRR
PFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAE
RVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSL
GKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKR
ARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISPGDFPSLRKMQ
ELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQVVKGGAFDGTMNG
PFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTV
LGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgttcagctgggtcagcaaggatgcccgccgcaagaaggagccggagctcttccagacg
gtggccgaggggctgcggcagctgtacgcgcagaagctgctacccctggaggagcactac
cgcttccacgagttccactcgcccgcgctggaggacgctgacttcgacaacaagcctatg
gtgctcctcgtggggcagtacagcacgggcaagaccaccttcatccgacacctgatcgag
caggacttcccggggatgcgcatcgggcccgagcccaccaccgactccttcatcgccgtc
atgcacggccccactgagggcgtggtgccgggcaacgcgctcgtggtggacccgcggcgc
cccttccgcaagctcaacgcgtttggcaacgctttcctcaacaggttcatgtgtgcccag
ctgcccaaccccgtcctggacagcatcagcatcatcgacacccccgggatcctgtctgga
gagaagcagcggatcagcagaggctatgactttgcagccgtcctggagtggttcgcggag
cgtgtggaccgcatcatcctgctcttcgacgcccacaagctggacatctccgatgagttc
tcggaagtgatcaaggctctgaagaaccatgaggacaagatccgcgtggtgctgaacaag
gcagaccagatcgagacgcagcagctgatgcgggtgtacggggccctcatgtggtccctg
ggcaagatcatcaacacccccgaggtggtcagggtctacatcggctccttctggtcccac
ccgctcctcatccccgacaaccgcaagctctttgaggccgaggagcaggacctcttcaag
gacatccagtcactgccccgaaacgccgccctcaggaagctcaatgacctgatcaagcgg
gcacggctggccaaggttcacgcctacatcatcagctccctcaagaaagagatgcccaat
gtctttggtaaagagagcaaaaagaaagagctggtgaacaacctgggagagatctaccag
aagattgagcgcgagcaccagatctcccctggggacttcccgagcctccgcaagatgcag
gaactcctgcagacccaggacttcagcaagttccaggcgctgaagcccaagctgctggac
acggtggatgacatgctggccaacgacatcgcgcggctgatggtgatggtgcggcaggag
gagtccctgatgccttcccaggtggtcaagggcggcgcctttgacggcaccatgaacggg
ccgttcgggcacggctacggcgagggggccggcgagggcatcgacgacgtggagtgggtg
gtgggcaaggacaagcccacctacgacgagatcttctacacgctgtcccctgtcaacggc
aagatcacgggcgccaacgccaagaaggagatggtgaagtccaagctccccaacaccgtg
ctagggaagatctggaagctggccgacgtggacaaggacgggctgctggacgacgaggag
ttcgcgctggccaaccacctcatcaaggtcaagctggagggccacgagctgcccgccgac
ctgcccccgcacctggtgccgccctccaagcgcagacatgagtga

DBGET integrated database retrieval system