KEGG   Homo sapiens (human): 10941
Entry
10941             CDS       T01001                                 

Gene name
UGT2A1, UDPGT2A1
Definition
(RefSeq) UDP glucuronosyltransferase family 2 member A1 complex locus
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa04976  Bile secretion
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    10941 (UGT2A1)
   00053 Ascorbate and aldarate metabolism
    10941 (UGT2A1)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    10941 (UGT2A1)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    10941 (UGT2A1)
   00860 Porphyrin and chlorophyll metabolism
    10941 (UGT2A1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    10941 (UGT2A1)
   00982 Drug metabolism - cytochrome P450
    10941 (UGT2A1)
   00983 Drug metabolism - other enzymes
    10941 (UGT2A1)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    10941 (UGT2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    10941 (UGT2A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    10941 (UGT2A1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     10941 (UGT2A1)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   10941 (UGT2A1)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C
Other DBs
NCBI-GeneID: 10941
NCBI-ProteinID: NP_001239204
OMIM: 604716
HGNC: 12542
Ensembl: ENSG00000173610
Vega: OTTHUMG00000184942
UniProt: Q9Y4X1
LinkDB
Position
4q13.3
AA seq 527 aa
MLNNLLLFSLQISLIGTTLGGNVLIWPMEGSHWLNVKIIIDELIKKEHNVTVLVASGALF
ITPTSNPSLTFEIYKVPFGKERIEGVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHM
VSQEICDGVLKNQQLMAKLKKSKFEVLVSDPVFPCGDIVALKLGIPFMYSLRFSPASTVE
KHCGKVPYPPSYVPAVLSELTDQMSFTDRIRNFISYHLQDYMFETLWKSWDSYYSKALGG
LLLCCPGWSAVADLGSLQPLLPGFKRFSRLSLHCSWDYRLPAGRPTTLCETMGKAEIWLI
RTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKVLWRYKGKKPATLGNNTQLFDWIPQNDL
LGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAVEVNLNTMTS
VDLLSALRTVINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHD
LTWFQYHSLDVIGFLLVCVTTAIFLVIQCCLFSCQKFGKIGKKKKRE
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgttaaacaaccttctgctgttctcccttcagataagtctcataggaaccactcttggt
gggaatgttttgatttggccaatggaaggtagtcattggctaaatgttaagataattata
gatgagctcattaaaaaggagcataatgtgactgtcctagttgcctctggtgcacttttc
atcacaccaacctctaacccatctctgacatttgaaatatataaggtgccctttggcaaa
gaaagaatagaaggagtaattaaggacttcgttttgacatggctggaaaatagaccatct
ccttcaaccatttggagattctatcaggagatggccaaagtaatcaaggacttccacatg
gtgtctcaggagatctgtgatggcgttcttaaaaaccaacagctgatggcaaagctaaag
aaaagcaagtttgaagtcctggtgtctgatccagtatttccttgtggcgatatagtagct
ttaaaacttggaattccatttatgtactccttgaggttttctccagcctcaacagtggaa
aagcactgtgggaaggtaccataccctccttcctatgttcctgctgttttatcagaactc
accgaccaaatgtctttcactgacagaataagaaatttcatctcctaccacctacaggac
tacatgtttgaaactctttggaaatcatgggattcatactatagtaaagctttaggtgga
ctcttactctgttgcccaggctggagtgcagtggcggatcttggctcactgcaacctctg
cttcccgggttcaagcgattctcccgcctcagcctccattgtagttgggattacaggctg
ccagcaggaagacccactacgttatgtgagactatggggaaagctgaaatttggttaatc
cgaacatattgggattttgaatttcctcgtccatacttacctaattttgagtttgttgga
ggattgcactgcaaacctgccaaacctttacctaaggttttatggagatacaaaggaaag
aaaccagccacattaggaaacaatactcagctctttgattggataccccagaatgatctt
cttggacatcccaaaaccaaagcttttatcactcatggtggaactaatgggatctacgaa
gctatttaccacggagtccctatggtgggagttcccatgtttgctgatcagcctgataac
attgctcacatgaaggccaaaggagcagctgtggaagtgaacctaaacacaatgacaagt
gtggatttgcttagcgctttgagaacagtcattaatgaaccttcttataaagagaatgct
atgaggttatcaagaattcaccatgatcaacctgtaaagcccctggatcgagcagtcttc
tggatcgagtttgtcatgcgccacaaaggagccaagcaccttcgggttgcagcccatgac
ctcacctggttccagtaccactctttggatgtaattgggttcttgctggtctgtgtgaca
acggctatatttttggtcatacaatgttgtttgttttcctgtcaaaaatttggtaagata
ggaaagaagaaaaaaagagaatag

DBGET integrated database retrieval system