KEGG   Homo sapiens (human): 10952Help
Entry
10952             CDS       T01001                                 

Gene name
SEC61B
Definition
(RefSeq) SEC61 translocon beta subunit
  KO
K09481  protein transport protein SEC61 subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
hsa04141  Protein processing in endoplasmic reticulum
hsa04145  Phagosome
hsa05110  Vibrio cholerae infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    10952 (SEC61B)
   04141 Protein processing in endoplasmic reticulum
    10952 (SEC61B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    10952 (SEC61B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    10952 (SEC61B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hsa02044]
    10952 (SEC61B)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   10952 (SEC61B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec61_beta
Motif
Other DBs
NCBI-GeneID: 10952
NCBI-ProteinID: NP_006799
OMIM: 609214
HGNC: 16993
Ensembl: ENSG00000106803
Vega: OTTHUMG00000020354
Pharos: P60468(Tbio)
UniProt: P60468
LinkDB All DBs
Position
9q22.33
AA seq 96 aa AA seqDB search
MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYT
EDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtccgacccccagtggcactaacgtgggatcctcagggcgctctcccagcaaa
gcagtggccgcccgggcggcgggatccactgtccggcagaggaaaaatgccagctgtggg
acaaggagtgcaggccgcacaacctcggcaggcaccggggggatgtggcgattctacaca
gaagattcacctgggctcaaagttggccctgttccagtattggttatgagtcttctgttc
atcgcttctgtatttatgttgcacatttggggcaagtacactcgttcgtag

KEGG   Homo sapiens (human): 23480Help
Entry
23480             CDS       T01001                                 

Gene name
SEC61G, SSS1
Definition
(RefSeq) SEC61 translocon gamma subunit
  KO
K07342  protein transport protein SEC61 subunit gamma and related proteins
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
hsa04141  Protein processing in endoplasmic reticulum
hsa04145  Phagosome
hsa05110  Vibrio cholerae infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    23480 (SEC61G)
   04141 Protein processing in endoplasmic reticulum
    23480 (SEC61G)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    23480 (SEC61G)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    23480 (SEC61G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hsa02044]
    23480 (SEC61G)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   23480 (SEC61G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SecE Pho88
Motif
Other DBs
NCBI-GeneID: 23480
NCBI-ProteinID: NP_001012474
OMIM: 609215
HGNC: 18277
Ensembl: ENSG00000132432
Vega: OTTHUMG00000023430
Pharos: P60059(Tdark)
UniProt: P60059 A0A024QYZ0
LinkDB All DBs
Position
7p11.2
AA seq 68 aa AA seqDB search
MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIP
INNIIVGG
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggtaatgcagtttgttgagccaagtcggcagtttgtaaaggactccattcgg
ctggttaaaagatgcactaaacctgatagaaaagaattccagaagattgccatggcaaca
gcaataggatttgctataatgggattcattggcttctttgtgaaattgatccatattcct
attaataacatcattgttggtggctga

KEGG   Homo sapiens (human): 29927Help
Entry
29927             CDS       T01001                                 

Gene name
SEC61A1, HNFJ4, HSEC61, SEC61, SEC61A
Definition
(RefSeq) SEC61 translocon alpha 1 subunit
  KO
K10956  protein transport protein SEC61 subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
hsa04141  Protein processing in endoplasmic reticulum
hsa04145  Phagosome
hsa05110  Vibrio cholerae infection
Disease
H00541  Autosomal dominant tubulointerstitial kidney disease
H02011  Familial juvenile hyperuricemic nephropathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    29927 (SEC61A1)
   04141 Protein processing in endoplasmic reticulum
    29927 (SEC61A1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    29927 (SEC61A1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    29927 (SEC61A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hsa02044]
    29927 (SEC61A1)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   29927 (SEC61A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SecY Plug_translocon DUF2975
Motif
Other DBs
NCBI-GeneID: 29927
NCBI-ProteinID: NP_037468
OMIM: 609213
HGNC: 18276
Ensembl: ENSG00000058262
Vega: OTTHUMG00000159624
Pharos: P61619(Tbio)
UniProt: P61619 B3KME8 B3KNF6
LinkDB All DBs
Position
3q21.3
AA seq 476 aa AA seqDB search
MAIKFLEVIKPFCVILPEIQKPERKIQFKEKVLWTAITLFIFLVCCQIPLFGIMSSDSAD
PFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFG
MIITIGQSIVYVMTGMYGDPSEMGAGICLLITIQLFVAGLIVLLLDELLQKGYGLGSGIS
LFIATNICETIVWKAFSPTTVNTGRGMEFEGAIIALFHLLATRTDKVRALREAFYRQNLP
NLMNLIATIFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSN
LYVISQMLSARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLEDPVH
AVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTA
AAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEVGSMGALLF
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcaaatttctggaagtcatcaagcccttctgtgtcatcctgccggaaattcag
aagccagagaggaagattcagtttaaggagaaagtgctgtggaccgctatcaccctcttt
atcttcttagtgtgctgccagattcccctgtttgggatcatgtcttcagattcagctgac
cctttctattggatgagagtgattctagcctctaacagaggcacattgatggagctaggg
atctctcctattgtcacgtctggccttataatgcaactcttggctggcgccaagataatt
gaagttggtgacaccccaaaagaccgagctctcttcaacggagcccaaaagttatttggc
atgatcattactatcggccagtctatcgtgtatgtgatgaccgggatgtatggggaccct
tctgaaatgggtgctggaatttgcctgctaatcaccattcagctctttgttgctggctta
attgtcctacttttggatgaactcctgcaaaaaggatatggccttggctctggtatttct
ctcttcattgcaactaacatctgtgaaaccatcgtatggaaggcattcagccccactact
gtcaacactggccgaggaatggaatttgaaggtgctatcatcgcacttttccatctgctg
gccacacgcacagacaaggtccgagcccttcgggaggcgttctaccgccagaatcttccc
aacctcatgaatctcatcgccaccatctttgtctttgcagtggtcatctatttccagggc
ttccgagtggacctgccaatcaagtcggcccgctaccgtggccagtacaacacctatccc
atcaagctcttctatacgtccaacatccccatcatcctgcagtctgccctggtgtccaac
ctttatgtcatctcccaaatgctctcagctcgcttcagtggcaacttgctggtcagcctg
ctgggcacctggtcggacacgtcttctgggggcccagcacgtgcttatccagttggtggc
ctttgctattacctgtcccctccagaatcttttggctccgtgttagaagacccggtccat
gcagttgtatacatagtgttcatgctgggctcctgtgcattcttctccaaaacgtggatt
gaggtctcaggttcctctgccaaagatgttgcaaagcagctgaaggagcagcagatggtg
atgagaggccaccgagagacctccatggtccatgaactcaaccggtacatccccacagcc
gcggcctttggtgggctgtgcatcggggccctctcggtcctggctgacttcctaggcgcc
attgggtctggaaccgggatcctgctcgcagtcacaatcatctaccagtactttgagatc
ttcgttaaggagcaaagcgaggttggcagcatgggggccctgctcttctga

KEGG   Homo sapiens (human): 55176Help
Entry
55176             CDS       T01001                                 

Gene name
SEC61A2
Definition
(RefSeq) SEC61 translocon alpha 2 subunit
  KO
K10956  protein transport protein SEC61 subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
hsa04141  Protein processing in endoplasmic reticulum
hsa04145  Phagosome
hsa05110  Vibrio cholerae infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    55176 (SEC61A2)
   04141 Protein processing in endoplasmic reticulum
    55176 (SEC61A2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    55176 (SEC61A2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    55176 (SEC61A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hsa02044]
    55176 (SEC61A2)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   55176 (SEC61A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SecY Plug_translocon
Motif
Other DBs
NCBI-GeneID: 55176
NCBI-ProteinID: NP_060614
OMIM: 618271
HGNC: 17702
Ensembl: ENSG00000065665
Vega: OTTHUMG00000017679
Pharos: Q9H9S3(Tdark)
UniProt: Q9H9S3 Q8TC24
LinkDB All DBs
Position
10p14
AA seq 476 aa AA seqDB search
MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSAD
PFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFG
MIITIGQAIVYVMTGMYGDPAEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGIS
LFIATNICETIVWKAFSPTTINTGRGTEFEGAVIALFHLLATRTDKVRALREAFYRQNLP
NLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSN
LYVISQMLSVRFSGNFLVNLLGQWADVSGGGPARSYPVGGLCYYLSPPESMGAIFEDPVH
VVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTA
AAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQAEVGGMGALFF
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcaaatttttagaagttatcaaaccattctgtgcagttctaccagaaattcag
aaaccggaaaggaaaatccagtttagagagaaggttctgtggactgctataacgctcttc
attttcttagtgtgttgtcagatcccactgtttggaatcatgtcatcagattctgcagat
cctttctactggatgagagttattctggcttccaatagaggaactttaatggaattgggt
atctccccaattgtaacatctggtttgattatgcagttgttagctggagccaaaatcatt
gaagttggagatacaccgaaagatagagctttattcaatggagcccagaaactgtttggt
atgatcattaccattgggcaagccattgtgtatgtcatgacggggatgtatggggaccct
gcagaaatgggtgccggaatctgtctcctgatcatcattcagttgtttgttgctggtttg
attgtgctgctgttagatgagctgctacagaagggttacggcttggggtctgggatttcc
ctctttattgccaccaacatctgtgagaccattgtctggaaggcctttagtcccactacc
attaacactggcagaggtactgagtttgagggtgcagtcatagctctgttccatttgttg
gccaccaggacggacaaagtccgagctttacgggaggctttttatcggcagaacttaccc
aatctcatgaacctcattgctacagtttttgtgtttgctgttgttatatatttccaagga
tttcgcgttgatctgcccattaagtcggcccgttaccgaggacagtacagcagctacccc
atcaaactcttctacacctccaacatccccatcatcctccagtcggccctggtgtccaac
ctgtatgttatttcccagatgctgtctgttcgatttagtggcaactttttagtaaattta
ctaggacagtgggccgatgtcagtgggggaggacccgcacgttcttacccagttggaggc
ctttgttactatctttctcctcctgagtccatgggcgccatctttgaggatcctgtccat
gtcgttgtttatatcatcttcatgttggggtcatgtgcattcttctctaagacatggatt
gaagtgtctggttcctcagccaaagatgtagctaaacagctgaaagaacagcagatggta
atgaggggccaccgagatacctctatggttcatgagcttaataggtacatccccaccgca
gctgcgtttggcggtttgtgcattggcgccctgtcagtgctggctgacttcctgggggcc
attggatctggcactggaattctgctagcagtcactattatttaccagtattttgaaata
tttgttaaagaacaggccgaagttggtgggatgggtgctttgtttttctaa

DBGET integrated database retrieval system