KEGG   Homo sapiens (human): 10971Help
Entry
10971             CDS       T01001                                 

Gene name
YWHAQ, 14-3-3, 1C5, HS1
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04390  Hippo signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05203  Viral carcinogenesis
Network
nt06110  MAPK signaling (virus)
nt06163  Hepatitis C virus (HCV)
  Element
N00518  HCV Core to ERK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    10971 (YWHAQ)
   04151 PI3K-Akt signaling pathway
    10971 (YWHAQ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    10971 (YWHAQ)
   04114 Oocyte meiosis
    10971 (YWHAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    10971 (YWHAQ)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10971 (YWHAQ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    10971 (YWHAQ)
   05160 Hepatitis C
    10971 (YWHAQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    10971 (YWHAQ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10971 (YWHAQ)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    10971 (YWHAQ)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   10971 (YWHAQ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 FliM
Motif
Other DBs
NCBI-GeneID: 10971
NCBI-ProteinID: NP_006817
OMIM: 609009
HGNC: 12854
Ensembl: ENSG00000134308
Vega: OTTHUMG00000013848
Pharos: P27348(Tbio)
UniProt: P27348
LinkDB All DBs
Structure
PDB: 

Position
2p25.1
AA seq 245 aa AA seqDB search
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggagaagactgagctgatccagaaggccaagctggccgagcaggccgagcgctacgac
gacatggccacctgcatgaaggcagtgaccgagcagggcgccgagctgtccaacgaggag
cgcaacctgctctccgtggcctacaagaacgtggtcgggggccgcaggtccgcctggagg
gtcatctctagcatcgagcagaagaccgacacctccgacaagaagttgcagctgattaag
gactatcgggagaaagtggagtccgagctgagatccatctgcaccacggtgctggaattg
ttggataaatatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaaa
atgaagggtgattacttccggtaccttgctgaagttgcgtgtggtgatgatcgaaaacaa
acgatagataattcccaaggagcttaccaagaggcatttgatataagcaagaaagagatg
caacccacacacccaatccgcctggggcttgctcttaacttttctgtattttactatgag
attcttaataacccagagcttgcctgcacgctggctaaaacggcttttgatgaggccatt
gctgaacttgatacactgaatgaagactcatacaaagacagcaccctcatcatgcagttg
cttagagacaacctaacactttggacatcagacagtgcaggagaagaatgtgatgcggca
gaaggggctgaaaactaa

KEGG   Homo sapiens (human): 7529Help
Entry
7529              CDS       T01001                                 

Gene name
YWHAB, GW128, HEL-S-1, HS1, KCIP-1, YWHAA
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04390  Hippo signaling pathway
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05203  Viral carcinogenesis
Network
nt06110  MAPK signaling (virus)
nt06163  Hepatitis C virus (HCV)
  Element
N00518  HCV Core to ERK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    7529 (YWHAB)
   04151 PI3K-Akt signaling pathway
    7529 (YWHAB)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7529 (YWHAB)
   04114 Oocyte meiosis
    7529 (YWHAB)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    7529 (YWHAB)
  09172 Infectious disease: viral
   05161 Hepatitis B
    7529 (YWHAB)
   05160 Hepatitis C
    7529 (YWHAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7529 (YWHAB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7529 (YWHAB)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    7529 (YWHAB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7529 (YWHAB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 FliM Peptidase_C98 DUF4518
Motif
Other DBs
NCBI-GeneID: 7529
NCBI-ProteinID: NP_003395
OMIM: 601289
HGNC: 12849
Ensembl: ENSG00000166913
Vega: OTTHUMG00000032549
Pharos: P31946(Tbio)
UniProt: P31946 V9HWD6
LinkDB All DBs
Structure
PDB: 

Position
20q13.12
AA seq 246 aa AA seqDB search
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFY
LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggataaaagtgagctggtacagaaagccaaactcgctgagcaggctgagcga
tatgatgatatggctgcagccatgaaggcagtcacagaacaggggcatgaactctccaac
gaagagagaaatctgctctctgttgcctacaagaatgtggtaggcgcccgccgctcttcc
tggcgtgtcatctccagcattgagcagaaaacagagaggaatgagaagaagcagcagatg
ggcaaagagtaccgtgagaagatagaggcagaactgcaggacatctgcaatgatgttctg
gagctgttggacaaatatcttattcccaatgctacacaaccagaaagtaaggtgttctac
ttgaaaatgaaaggagattattttaggtatctttctgaagtggcatctggagacaacaaa
caaaccactgtgtcgaactcccagcaggcttaccaggaagcatttgaaattagtaagaaa
gaaatgcagcctacacacccaattcgtcttggtctggcactaaatttctcagtcttttac
tatgagattctaaactctcctgaaaaggcctgtagcctggcaaaaacggcatttgatgaa
gcaattgctgaattggatacgctgaatgaagagtcttataaagacagcactctgatcatg
cagttacttagggacaatctcactctgtggacatcggaaaaccagggagacgaaggagac
gctggggagggagagaactaa

KEGG   Homo sapiens (human): 7531Help
Entry
7531              CDS       T01001                                 

Gene name
YWHAE, 14-3-3E, HEL2, KCIP-1, MDCR, MDS
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon
  KO
K06630  14-3-3 protein epsilon
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04390  Hippo signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa05160  Hepatitis C
hsa05203  Viral carcinogenesis
Network
nt06110  MAPK signaling (virus)
nt06163  Hepatitis C virus (HCV)
  Element
N00518  HCV Core to ERK signaling pathway
Disease
H00268  Lissencephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    7531 (YWHAE)
   04151 PI3K-Akt signaling pathway
    7531 (YWHAE)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7531 (YWHAE)
   04114 Oocyte meiosis
    7531 (YWHAE)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    7531 (YWHAE)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    7531 (YWHAE)
  09172 Infectious disease: viral
   05160 Hepatitis C
    7531 (YWHAE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7531 (YWHAE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7531 (YWHAE)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    7531 (YWHAE)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7531 (YWHAE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 Orbi_VP5
Motif
Other DBs
NCBI-GeneID: 7531
NCBI-ProteinID: NP_006752
OMIM: 605066
HGNC: 12851
Ensembl: ENSG00000108953
Vega: OTTHUMG00000134316
Pharos: P62258(Tbio)
UniProt: P62258 V9HW98
LinkDB All DBs
Structure
PDB: 

Position
17p13.3
AA seq 255 aa AA seqDB search
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggatgatcgagaggatctggtgtaccaggcgaagctggccgagcaggctgagcgatac
gacgaaatggtggagtcaatgaagaaagtagcagggatggatgtggagctgacagttgaa
gaaagaaacctcctatctgttgcatataagaatgtgattggagctagaagagcctcctgg
agaataatcagcagcattgaacagaaagaagaaaacaagggaggagaagacaagctaaaa
atgattcgggaatatcggcaaatggttgagactgagctaaagttaatctgttgtgacatt
ctggatgtactggacaaacacctcattccagcagctaacactggcgagtccaaggttttc
tattataaaatgaaaggggactaccacaggtatctggcagaatttgccacaggaaacgac
aggaaggaggctgcggagaacagcctagtggcttataaagctgctagtgatattgcaatg
acagaacttccaccaacgcatcctattcgcttaggtcttgctctcaatttttccgtattc
tactacgaaattcttaattcccctgaccgtgcctgcaggttggcaaaagcagcttttgat
gatgcaattgcagaactggatacgctgagtgaagaaagctataaggactctacacttatc
atgcagttgttacgtgataatctgacactatggacttcagacatgcagggtgacggtgaa
gagcagaataaagaagcgctgcaggacgtggaagacgaaaatcagtga

KEGG   Homo sapiens (human): 7532Help
Entry
7532              CDS       T01001                                 

Gene name
YWHAG, 14-3-3GAMMA, EIEE56, PPP1R170
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma
  KO
K16198  14-3-3 protein gamma/eta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04390  Hippo signaling pathway
hsa05160  Hepatitis C
hsa05203  Viral carcinogenesis
Network
nt06110  MAPK signaling (virus)
nt06163  Hepatitis C virus (HCV)
  Element
N00518  HCV Core to ERK signaling pathway
Disease
H00606  Early infantile epileptic encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    7532 (YWHAG)
   04151 PI3K-Akt signaling pathway
    7532 (YWHAG)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7532 (YWHAG)
   04114 Oocyte meiosis
    7532 (YWHAG)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    7532 (YWHAG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    7532 (YWHAG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    7532 (YWHAG)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7532 (YWHAG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7532 (YWHAG)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     7532 (YWHAG)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    7532 (YWHAG)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7532 (YWHAG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 DUF722 Peptidase_C98 Orbi_VP5 SF3A2 FlaC_arch
Motif
Other DBs
NCBI-GeneID: 7532
NCBI-ProteinID: NP_036611
OMIM: 605356
HGNC: 12852
Ensembl: ENSG00000170027
Vega: OTTHUMG00000022862
Pharos: P61981(Tbio)
UniProt: P61981
LinkDB All DBs
Structure
PDB: 

Position
7q11.23
AA seq 247 aa AA seqDB search
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggtggaccgcgagcaactggtgcagaaagcccggctggccgagcaggcggagcgctac
gacgacatggccgcggccatgaagaacgtgacagagctgaatgagccactgtcgaatgag
gaacgaaaccttctgtctgtggcctacaagaacgttgtgggggcacgccgctcttcctgg
agggtcatcagtagcattgagcagaagacatctgcagacggcaatgagaagaagattgag
atggtccgtgcgtaccgggagaagatagagaaggagttggaggctgtgtgccaggatgtg
ctgagcctgctggataactacctgatcaagaattgcagcgagacccagtacgagagcaaa
gtgttctacctgaagatgaaaggggactactaccgctacctggctgaagtggccaccgga
gagaaaagggcgacggtggtggagtcctccgagaaggcctacagcgaagcccacgagatc
agcaaagagcacatgcagcccacccaccccatccgattaggcctggctcttaactactcc
gtcttctactatgagatccagaacgccccagagcaagcgtgccacttggccaagaccgcg
ttcgacgacgccatcgccgagcttgacaccctcaacgaggactcctacaaggactccacg
ctcatcatgcagctcctccgcgacaacctcacgctctggacgagcgaccagcaggacgac
gatggcggcgaaggcaacaattaa

KEGG   Homo sapiens (human): 7533Help
Entry
7533              CDS       T01001                                 

Gene name
YWHAH, YWHA1
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta
  KO
K16198  14-3-3 protein gamma/eta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04390  Hippo signaling pathway
hsa05160  Hepatitis C
hsa05203  Viral carcinogenesis
Network
nt06110  MAPK signaling (virus)
nt06163  Hepatitis C virus (HCV)
  Element
N00518  HCV Core to ERK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    7533 (YWHAH)
   04151 PI3K-Akt signaling pathway
    7533 (YWHAH)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7533 (YWHAH)
   04114 Oocyte meiosis
    7533 (YWHAH)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    7533 (YWHAH)
  09172 Infectious disease: viral
   05160 Hepatitis C
    7533 (YWHAH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    7533 (YWHAH)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7533 (YWHAH)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7533 (YWHAH)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     7533 (YWHAH)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    7533 (YWHAH)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7533 (YWHAH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 DUF722 CodY
Motif
Other DBs
NCBI-GeneID: 7533
NCBI-ProteinID: NP_003396
OMIM: 113508
HGNC: 12853
Ensembl: ENSG00000128245
Vega: OTTHUMG00000030833
Pharos: Q04917(Tbio)
UniProt: Q04917 A0A024R1K7 Q9H4N8
LinkDB All DBs
Structure
PDB: 

Position
22q12.3
AA seq 246 aa AA seqDB search
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSW
RVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESK
VFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFS
VFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDE
EAGEGN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgggggaccgggagcagctgctgcagcgggcgcggctggccgagcaggcggagcgctac
gacgacatggcctccgctatgaaggcggtgacagagctgaatgaacctctctccaatgaa
gatcgaaatctcctctctgtggcctacaagaatgtggttggtgccaggcgatcttcctgg
agggtcattagcagcattgagcagaaaaccatggctgatggaaacgaaaagaaattggag
aaagttaaagcttaccgggagaagattgagaaggagctggagacagtttgcaatgatgtc
ctgtctctgcttgacaagttcctgatcaagaactgcaatgatttccagtatgagagcaag
gtgttttacctgaaaatgaagggtgattactaccgctacttagcagaggtcgcttctggg
gagaagaaaaacagtgtggtcgaagcttctgaagctgcctacaaggaagcctttgaaatc
agcaaagagcagatgcaacccacgcatcccatccggctgggcctggccctcaacttctcc
gtgttctactatgagatccagaatgcacctgagcaagcctgcctcttagccaaacaagcc
ttcgatgatgccatagctgagctggacacactaaacgaggattcctataaggactccacg
ctgatcatgcagttgctgcgagacaacctcaccctctggacgagcgaccagcaggatgaa
gaagcaggagaaggcaactga

KEGG   Homo sapiens (human): 7534Help
Entry
7534              CDS       T01001                                 

Gene name
YWHAZ, 14-3-3-zeta, HEL-S-3, HEL-S-93, HEL4, KCIP-1, POPCHAS, YWHAD
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04390  Hippo signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05203  Viral carcinogenesis
Network
nt06110  MAPK signaling (virus)
nt06163  Hepatitis C virus (HCV)
  Element
N00518  HCV Core to ERK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    7534 (YWHAZ)
   04151 PI3K-Akt signaling pathway
    7534 (YWHAZ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7534 (YWHAZ)
   04114 Oocyte meiosis
    7534 (YWHAZ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    7534 (YWHAZ)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    7534 (YWHAZ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    7534 (YWHAZ)
   05160 Hepatitis C
    7534 (YWHAZ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7534 (YWHAZ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7534 (YWHAZ)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    7534 (YWHAZ)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7534 (YWHAZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 FliM Peptidase_C98 CSN7a_helixI
Motif
Other DBs
NCBI-GeneID: 7534
NCBI-ProteinID: NP_001129171
OMIM: 601288
HGNC: 12855
Ensembl: ENSG00000164924
Vega: OTTHUMG00000134291
Pharos: P63104(Tbio)
UniProt: P63104 D0PNI1
LinkDB All DBs
Structure
PDB: 

Position
8q22.3
AA seq 245 aa AA seqDB search
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaatgagctggttcagaaggccaaactggccgagcaggctgagcgatatgat
gacatggcagcctgcatgaagtctgtaactgagcaaggagctgaattatccaatgaggag
aggaatcttctctcagttgcttataaaaatgttgtaggagcccgtaggtcatcttggagg
gtcgtctcaagtattgaacaaaagacggaaggtgctgagaaaaaacagcagatggctcga
gaatacagagagaaaattgagacggagctaagagatatctgcaatgatgtactgtctctt
ttggaaaagttcttgatccccaatgcttcacaagcagagagcaaagtcttctatttgaaa
atgaaaggagattactaccgttacttggctgaggttgccgctggtgatgacaagaaaggg
attgtcgatcagtcacaacaagcataccaagaagcttttgaaatcagcaaaaaggaaatg
caaccaacacatcctatcagactgggtctggcccttaacttctctgtgttctattatgag
attctgaactccccagagaaagcctgctctcttgcaaagacagcttttgatgaagccatt
gctgaacttgatacattaagtgaagagtcatacaaagacagcacgctaataatgcaatta
ctgagagacaacttgacattgtggacatcggatacccaaggagacgaagctgaagcagga
gaaggaggggaaaattaa

DBGET integrated database retrieval system