KEGG   Homo sapiens (human): 10991Help
Entry
10991             CDS       T01001                                 

Gene name
SLC38A3, G17, NAT1, SN1, SNAT3
Definition
(RefSeq) solute carrier family 38 member 3
  KO
K13576  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04724  Glutamatergic synapse
hsa04727  GABAergic synapse
hsa04964  Proximal tubule bicarbonate reclamation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    10991 (SLC38A3)
  09156 Nervous system
   04724 Glutamatergic synapse
    10991 (SLC38A3)
   04727 GABAergic synapse
    10991 (SLC38A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    10991 (SLC38A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   10991 (SLC38A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aa_trans DUF3262
Motif
Other DBs
NCBI-GeneID: 10991
NCBI-ProteinID: NP_006832
OMIM: 604437
HGNC: 18044
Ensembl: ENSG00000188338
Vega: OTTHUMG00000156764
Pharos: Q99624(Tbio)
UniProt: Q99624
LinkDB All DBs
Position
3p21.31
AA seq 504 aa AA seqDB search
MEAPLQTEMVELVPNGKHSEGLLPVITPMAGNQRVEDPARSCMEGKSFLQKSPSKEPHFT
DFEGKTSFGMSVFNLSNAIMGSGILGLAYAMANTGIILFLFLLTAVALLSSYSIHLLLKS
SGVVGIRAYEQLGYRAFGTPGKLAAALAITLQNIGAMSSYLYIIKSELPLVIQTFLNLEE
KTSDWYMNGNYLVILVSVTIILPLALMRQLGYLGYSSGFSLSCMVFFLIAVIYKKFHVPC
PLPPNFNNTTGNFSHVEIVKEKVQLQVEPEASAFCTPSYFTLNSQTAYTIPIMAFAFVCH
PEVLPIYTELKDPSKKKMQHISNLSIAVMYIMYFLAALFGYLTFYNGVESELLHTYSKVD
PFDVLILCVRVAVLTAVTLTVPIVLFPVRRAIQQMLFPNQEFSWLRHVLIAVGLLTCINL
LVIFAPNILGIFGVIGATSAPFLIFIFPAIFYFRIMPTEKEPARSTPKILALCFAMLGFL
LMTMSLSFIIIDWASGTSRHGGNH
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgcctttgcagacagagatggtggagctggtgcccaatggcaaacactcagag
gggctgctcccggtcatcacccccatggcaggcaaccagagggtcgaggaccctgcacgg
agctgtatggagggcaagagcttcctacagaaaagtcccagcaaggagccacacttcact
gacttcgaggggaagacatcattcgggatgtcagtgttcaacctcagcaatgccatcatg
ggcagcggcatcctgggactcgcctatgccatggccaatacgggcattatccttttcctg
ttcctgttgacagctgtcgccttgctctccagctactccatccacctgctactcaagtcc
tcaggggtcgtgggcatccgtgcctatgagcagctgggctaccgtgcctttgggacccca
ggaaagctggcagcagccctggccatcacgctccagaacatcggagccatgtccagctac
ctgtacatcatcaagtctgagctgccacttgtcatacagaccttcctgaacctggaggag
aaaacctcggactggtacatgaacgggaactacctggtaatccttgtctctgtcaccatc
attctgcccctggcactgatgcggcagcttggctacctgggctactccagcggcttctct
cttagctgcatggtgttcttcctaattgcagtcatctacaaaaagttccacgtgccctgc
ccactgccccccaacttcaacaacaccacaggcaacttcagccacgtggagatcgtgaag
gagaaggtgcagctgcaggtcgagcctgaggcttcagccttctgcactcccagctacttc
acgctcaactcacagacagcatacaccatccccatcatggccttcgccttcgtctgccac
cccgaggtgctgcccatctatactgagctcaaggacccctccaagaagaagatgcagcac
atctccaacctgtccatcgctgtcatgtacatcatgtacttcctggctgccctcttcggc
tacctcaccttctacaacggggtggagtcggagctgctgcacacctacagcaaggtggac
ccgtttgacgtcctgatcctgtgtgtgcgcgtggccgtgctgacagcagtcacgctcaca
gtgcccatcgttctgttcccggtgcgccgcgccatccagcagatgctgtttccaaaccag
gagttcagctggctgcggcatgtgcttattgccgttggcctgctcacttgtatcaacctg
ctggtcatctttgcccccaacatcctgggcatctttggggtcatcggtgccacatctgcc
ccattcctcatcttcatcttccctgccatcttctacttccgaatcatgcccacggagaag
gagcctgcaagatccacccccaaaatcctggccctgtgttttgctatgcttggcttcttg
ctgatgaccatgagcttgagcttcatcatcattgactgggcctcagggaccagccggcat
ggaggaaaccactag

DBGET integrated database retrieval system