KEGG   Homo sapiens (human): 10998
Entry
10998             CDS       T01001                                 

Gene name
SLC27A5, ACSB, ACSVL6, BACS, BAL, FACVL3, FATP-5, FATP5, VLACSR, VLCS-H2, VLCSH2
Definition
(RefSeq) solute carrier family 27 member 5
  KO
K08748  solute carrier family 27 (fatty acid transporter), member 5 [EC:6.2.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00120  Primary bile acid biosynthesis
hsa01100  Metabolic pathways
hsa03320  PPAR signaling pathway
hsa04931  Insulin resistance
hsa04976  Bile secretion
Module
hsa_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
hsa_M00106  Conjugated bile acid biosynthesis, cholate => taurocholate/glycocholate
Network
nt06022  Bile acid biosynthesis
  Element
N00805  Bile acid biosynthesis
N00806  ACOX2 deficiency in bile acid biosynthesis
N00807  AMACR deficiency in bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    10998 (SLC27A5)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    10998 (SLC27A5)
  09154 Digestive system
   04976 Bile secretion
    10998 (SLC27A5)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    10998 (SLC27A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    10998 (SLC27A5)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.7  cholate---CoA ligase
     10998 (SLC27A5)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   10998 (SLC27A5)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C XdhC_CoxI
Other DBs
NCBI-GeneID: 10998
NCBI-ProteinID: NP_036386
OMIM: 603314
HGNC: 10999
Ensembl: ENSG00000083807
Vega: OTTHUMG00000183543
Pharos: Q9Y2P5(Tbio)
UniProt: Q9Y2P5
LinkDB
Position
19q13.43
AA seq 690 aa
MGVRQQLALLLLLLLLLWGLGQPVWPVAVALTLRWLLGDPTCCVLLGLAMLARPWLGPWV
PHGLSLAAAALALTLLPARLPPGLRWLPADVIFLAKILHLGLKIRGCLSRQPPDTFVDAF
ERRARAQPGRALLVWTGPGAGSVTFGELDARACQAAWALKAELGDPASLCAGEPTALLVL
ASQAVPALCMWLGLAKLGCPTAWINPHGRGMPLAHSVLSSGARVLVVDPDLRESLEEILP
KLQAENIRCFYLSHTSPTPGVGALGAALDAAPSHPVPADLRAGITWRSPALFIYTSGTTG
LPKPAILTHERVLQMSKMLSLSGATADDVVYTVLPLYHVMGLVVGILGCLDLGATCVLAP
KFSTSCFWDDCRQHGVTVILYVGELLRYLCNIPQQPEDRTHTVRLAMGNGLRADVWETFQ
QRFGPIRIWEVYGSTEGNMGLVNYVGRCGALGKMSCLLRMLSPFELVQFDMEAAEPVRDN
QGFCIPVGLGEPGLLLTKVVSQQPFVGYRGPRELSERKLVRNVRQSGDVYYNTGDVLAMD
REGFLYFRDRLGDTFRWKGENVSTHEVEGVLSQVDFLQQVNVYGVCVPGCEGKVGMAAVQ
LAPGQTFDGEKLYQHVRAWLPAYATPHFIRIQDAMEVTSTFKLMKTRLVREGFNVGIVVD
PLFVLDNRAQSFRPLTAEMYQAVCEGTWRL
NT seq 2073 nt   +upstreamnt  +downstreamnt
atgggtgtcaggcaacagttggccttgctgctgctgctgctgctcctgctctggggcctg
gggcagccagtgtggccagtcgctgtggccttgaccctgcgctggctcctgggggatccc
acatgttgcgtgctacttgggctggccatgttagcacggccctggctcggcccctgggtg
ccccatgggctgagcctggcagctgcggccctggcactaaccctcctgccagcacggctg
cccccaggactacgctggctgccggctgatgtgatcttcttggccaagatcctccacctg
ggcctgaagatcaggggatgcttgagccggcagccgcctgacacctttgtagatgccttc
gagcggcgagcacgagcgcagcctggcagggcactcttggtgtggacggggcctggggcc
ggctcagtcacctttggtgagctggatgcccgggcctgccaggcggcatgggccctgaag
gctgagctgggtgaccctgcgagcctgtgtgccggggagcctactgccctccttgtgctg
gcttcccaggccgttccagccctgtgtatgtggctggggctggccaagctgggctgccca
acagcctggatcaacccgcatggccgggggatgcccctggcgcactctgtgctgagctct
ggggcccgggtgctggtggtggacccagacctccgggagagcctggaggagatccttccc
aagctgcaggctgagaacatccgctgcttctacctcagccatacctcccctacaccaggg
gtgggggctctgggggctgccctggatgcagcgccctcccacccagtgcctgctgacctg
cgtgctgggatcacatggagaagccctgccctcttcatctatacctcggggaccactggc
ctcccgaagccagccatcctcacgcatgagcgggtactgcagatgagcaagatgctgtcc
ttatctggggccacagctgatgatgtggtttacacggtcctgcctctgtaccacgtgatg
ggacttgtcgttgggatcctcggctgcttagatctcggagccacctgtgttctggccccc
aagttctctacttcctgcttctgggatgactgtcggcagcatggcgtgacagtgatcctg
tatgtgggcgagctcctgcggtacttgtgtaacattccccagcaaccagaggaccggaca
catacagtccgcctggcaatgggcaatggactacgggctgatgtgtgggagaccttccag
cagcgcttcggtcctattcggatctgggaagtctacggctccacagaaggcaacatgggc
ttagtcaactatgtggggcgctgcggggccctgggcaagatgagctgcctcctccgaatg
ctgtccccctttgagctggtgcagttcgacatggaggcggcggagcctgtgagggacaat
cagggcttctgcatccctgtagggctaggggagccggggctgctgctgaccaaggtggta
agccagcaacccttcgtgggctaccgcggcccccgagagctgtcggaacggaagctggtg
cgcaacgtgcggcaatcgggcgacgtttactacaacaccggggacgtactggccatggac
cgcgaaggcttcctctacttccgcgaccgcctcggggacaccttccgatggaagggcgag
aacgtgtccacgcacgaggtggagggcgtgttgtcgcaggtggacttcttgcaacaggtt
aacgtgtatggcgtgtgcgtgccaggttgtgagggtaaggtgggcatggctgctgtgcag
ctagcccccggccagactttcgacggggagaagttgtaccagcacgttcgcgcttggctc
cctgcctacgctaccccccatttcatccgcatccaggacgccatggaggtcaccagcacg
ttcaaactgatgaagacccggttggtgcgtgagggcttcaatgtggggatcgtggttgac
cctctgtttgtactggacaaccgggcccagtccttccggcccctgacggcagaaatgtac
caggctgtgtgtgagggaacctggaggctctga

DBGET integrated database retrieval system