KEGG   Homo sapiens (human): 10998
Entry
10998             CDS       T01001                                 

Gene name
SLC27A5, ACSB, ACSVL6, BACS, BAL, FACVL3, FATP-5, FATP5, VLACSR, VLCS-H2, VLCSH2
Definition
(RefSeq) solute carrier family 27 member 5
  KO
K08748  solute carrier family 27 (fatty acid transporter), member 5 [EC:6.2.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00120  Primary bile acid biosynthesis
hsa01100  Metabolic pathways
hsa03320  PPAR signaling pathway
hsa04931  Insulin resistance
hsa04976  Bile secretion
Module
hsa_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
hsa_M00106  Conjugated bile acid biosynthesis, cholate => taurocholate/glycocholate
Network
nt06022  Bile acid biosynthesis
  Element
N00805  Bile acid biosynthesis
N00806  ACOX2 deficiency in bile acid biosynthesis
N00807  AMACR deficiency in bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    10998 (SLC27A5)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    10998 (SLC27A5)
  09154 Digestive system
   04976 Bile secretion
    10998 (SLC27A5)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    10998 (SLC27A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    10998 (SLC27A5)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.7  cholate---CoA ligase
     10998 (SLC27A5)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   10998 (SLC27A5)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C XdhC_CoxI
Other DBs
NCBI-GeneID: 10998
NCBI-ProteinID: NP_036386
OMIM: 603314
HGNC: 10999
Ensembl: ENSG00000083807
Vega: OTTHUMG00000183543
Pharos: Q9Y2P5(Tbio)
UniProt: Q9Y2P5
LinkDB
Position
19q13.43
AA seq 690 aa
MGVRQQLALLLLLLLLLWGLGQPVWPVAVALTLRWLLGDPTCCVLLGLAMLARPWLGPWV
PHGLSLAAAALALTLLPARLPPGLRWLPADVIFLAKILHLGLKIRGCLSRQPPDTFVDAF
ERRARAQPGRALLVWTGPGAGSVTFGELDARACQAAWALKAELGDPASLCAGEPTALLVL
ASQAVPALCMWLGLAKLGCPTAWINPHGRGMPLAHSVLSSGARVLVVDPDLRESLEEILP
KLQAENIRCFYLSHTSPTPGVGALGAALDAAPSHPVPADLRAGITWRSPALFIYTSGTTG
LPKPAILTHERVLQMSKMLSLSGATADDVVYTVLPLYHVMGLVVGILGCLDLGATCVLAP
KFSTSCFWDDCRQHGVTVILYVGELLRYLCNIPQQPEDRTHTVRLAMGNGLRADVWETFQ
QRFGPIRIWEVYGSTEGNMGLVNYVGRCGALGKMSCLLRMLSPFELVQFDMEAAEPVRDN
QGFCIPVGLGEPGLLLTKVVSQQPFVGYRGPRELSERKLVRNVRQSGDVYYNTGDVLAMD
REGFLYFRDRLGDTFRWKGENVSTHEVEGVLSQVDFLQQVNVYGVCVPGCEGKVGMAAVQ
LAPGQTFDGEKLYQHVRAWLPAYATPHFIRIQDAMEVTSTFKLMKTRLVREGFNVGIVVD
PLFVLDNRAQSFRPLTAEMYQAVCEGTWRL
NT seq 2073 nt   +upstreamnt  +downstreamnt
atgggtgtcaggcaacagttggccttgctgctgctgctgctgctcctgctctggggcctg
gggcagccagtgtggccagtcgctgtggccttgaccctgcgctggctcctgggggatccc
acatgttgcgtgctacttgggctggccatgttagcacggccctggctcggcccctgggtg
ccccatgggctgagcctggcagctgcggccctggcactaaccctcctgccagcacggctg
cccccaggactacgctggctgccggctgatgtgatcttcttggccaagatcctccacctg
ggcctgaagatcaggggatgcttgagccggcagccgcctgacacctttgtagatgccttc
gagcggcgagcacgagcgcagcctggcagggcactcttggtgtggacggggcctggggcc
ggctcagtcacctttggtgagctggatgcccgggcctgccaggcggcatgggccctgaag
gctgagctgggtgaccctgcgagcctgtgtgccggggagcctactgccctccttgtgctg
gcttcccaggccgttccagccctgtgtatgtggctggggctggccaagctgggctgccca
acagcctggatcaacccgcatggccgggggatgcccctggcgcactctgtgctgagctct
ggggcccgggtgctggtggtggacccagacctccgggagagcctggaggagatccttccc
aagctgcaggctgagaacatccgctgcttctacctcagccatacctcccctacaccaggg
gtgggggctctgggggctgccctggatgcagcgccctcccacccagtgcctgctgacctg
cgtgctgggatcacatggagaagccctgccctcttcatctatacctcggggaccactggc
ctcccgaagccagccatcctcacgcatgagcgggtactgcagatgagcaagatgctgtcc
ttatctggggccacagctgatgatgtggtttacacggtcctgcctctgtaccacgtgatg
ggacttgtcgttgggatcctcggctgcttagatctcggagccacctgtgttctggccccc
aagttctctacttcctgcttctgggatgactgtcggcagcatggcgtgacagtgatcctg
tatgtgggcgagctcctgcggtacttgtgtaacattccccagcaaccagaggaccggaca
catacagtccgcctggcaatgggcaatggactacgggctgatgtgtgggagaccttccag
cagcgcttcggtcctattcggatctgggaagtctacggctccacagaaggcaacatgggc
ttagtcaactatgtggggcgctgcggggccctgggcaagatgagctgcctcctccgaatg
ctgtccccctttgagctggtgcagttcgacatggaggcggcggagcctgtgagggacaat
cagggcttctgcatccctgtagggctaggggagccggggctgctgctgaccaaggtggta
agccagcaacccttcgtgggctaccgcggcccccgagagctgtcggaacggaagctggtg
cgcaacgtgcggcaatcgggcgacgtttactacaacaccggggacgtactggccatggac
cgcgaaggcttcctctacttccgcgaccgcctcggggacaccttccgatggaagggcgag
aacgtgtccacgcacgaggtggagggcgtgttgtcgcaggtggacttcttgcaacaggtt
aacgtgtatggcgtgtgcgtgccaggttgtgagggtaaggtgggcatggctgctgtgcag
ctagcccccggccagactttcgacggggagaagttgtaccagcacgttcgcgcttggctc
cctgcctacgctaccccccatttcatccgcatccaggacgccatggaggtcaccagcacg
ttcaaactgatgaagacccggttggtgcgtgagggcttcaatgtggggatcgtggttgac
cctctgtttgtactggacaaccgggcccagtccttccggcccctgacggcagaaatgtac
caggctgtgtgtgagggaacctggaggctctga

KEGG   Homo sapiens (human): 10999
Entry
10999             CDS       T01001                                 

Gene name
SLC27A4, ACSVL4, FATP4, IPS
Definition
(RefSeq) solute carrier family 27 member 4
  KO
K08745  solute carrier family 27 (fatty acid transporter), member 1/4 [EC:6.2.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04931  Insulin resistance
hsa04975  Fat digestion and absorption
Disease
H00741  Ichthyosis prematurity syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    10999 (SLC27A4)
  09154 Digestive system
   04975 Fat digestion and absorption
    10999 (SLC27A4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    10999 (SLC27A4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    10999 (SLC27A4)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    10999 (SLC27A4)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     10999 (SLC27A4)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   10999 (SLC27A4)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   10999 (SLC27A4)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 10999
NCBI-ProteinID: NP_005085
OMIM: 604194
HGNC: 10998
Ensembl: ENSG00000167114
Vega: OTTHUMG00000020746
Pharos: Q6P1M0(Tchem)
UniProt: Q6P1M0 A0A024R8D2
LinkDB
Position
9q34.11
AA seq 643 aa
MLLGASLVGVLLFSKLVLKLPWTQVGFSLLFLYLGSGGWRFIRVFIKTIRRDIFGGLVLL
KVKAKVRQCLQERRTVPILFASTVRRHPDKTALIFEGTDTHWTFRQLDEYSSSVANFLQA
RGLASGDVAAIFMENRNEFVGLWLGMAKLGVEAALINTNLRRDALLHCLTTSRARALVFG
SEMASAICEVHASLDPSLSLFCSGSWEPGAVPPSTEHLDPLLKDAPKHLPSCPDKGFTDK
LFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGFRMRPNDIVYDCLPLYHSAGNIVGIGQ
CLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYLLNQPPREAENQHQVRMALG
NGLRQSIWTNFSSRFHIPQVAEFYGATECNCSLGNFDSQVGACGFNSRILSFVYPIRLVR
VNEDTMELIRGPDGVCIPCQPGEPGQLVGRIIQKDPLRRFDGYLNQGANNKKIAKDVFKK
GDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVE
VPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTE
LRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgctgcttggagcctctctggtgggggtgctgctgttctccaagctggtgctgaaactg
ccctggacccaggtgggattctccctgttgttcctctacttgggatctggcggctggcgc
ttcatccgggtcttcatcaagaccatcaggcgcgatatctttggcggcctggtcctcctg
aaggtgaaggcaaaggtgcgacagtgcctgcaggagcggcggacagtgcccattttgttt
gcctctaccgttcggcgccaccccgacaagacggccctgatcttcgagggcacagatacc
cactggaccttccgccagctggatgagtactcaagcagtgtagccaacttcctgcaggcc
cggggcctggcctcgggcgatgtggctgccatcttcatggagaaccgcaatgagttcgtg
ggcctatggctgggcatggccaagctcggtgtggaggcagccctcatcaacaccaacctg
cggcgggatgctctgctccactgcctcaccacctcgcgcgcacgggcccttgtctttggc
agcgaaatggcctcagccatctgtgaggtccatgccagcctggacccctcgctcagcctc
ttctgctctggctcctgggagcccggtgcggtgcctccaagcacagaacacctggaccct
ctgctgaaagatgctcccaagcaccttcccagttgccctgacaagggcttcacagataaa
ctgttctacatctacacatccggcaccacagggctgcccaaggccgccatcgtggtgcac
agcaggtattaccgcatggctgccctggtgtactatggattccgcatgcggcccaacgac
atcgtctatgactgcctccccctctaccactcagcaggaaacatcgtgggaatcggccag
tgcctgctgcatggcatgacggtggtgattcggaagaagttctcagcctcccggttctgg
gacgattgtatcaagtacaactgcacgattgtgcagtacattggtgaactgtgccgctac
ctcctgaaccagccaccgcgggaggcagaaaaccagcaccaggttcgcatggcactaggc
aatggcctccggcagtccatctggaccaacttttccagccgcttccacataccccaggtg
gctgagttctacggggccacagagtgcaactgtagcctgggcaacttcgacagccaggtg
ggggcctgtggtttcaatagccgcatcctgtccttcgtgtaccccatccggttggtacgt
gtcaacgaggacaccatggagctgatccgggggcccgacggcgtctgcattccctgccag
ccaggtgagccgggccagctggtgggccgcatcatccagaaagaccccctgcgccgcttc
gatggctacctcaaccagggcgccaacaacaagaagattgccaaggatgtcttcaagaag
ggggaccaggcctaccttactggtgatgtgctggtgatggacgagctgggctacctgtac
ttccgagaccgcactggggacacgttccgctggaaaggtgagaacgtgtccaccaccgag
gtggaaggcacactcagccgcctgctggacatggctgacgtggccgtgtatggtgtcgag
gtgccaggaaccgagggccgggccggaatggctgctgtggccagccccactggcaactgt
gacctggagcgctttgctcaggtcttggagaaggaactgcccctgtatgcgcgccccatc
ttcctgcgcctcctgcctgagctgcacaaaacaggaacctacaagttccagaagacagag
ctacggaaggagggctttgacccggctattgtgaaagacccgctgttctatctagatgcc
cagaagggccgctacgtcccgctggaccaagaggcctacagccgcatccaggcaggcgag
gagaagctgtga

KEGG   Homo sapiens (human): 11001
Entry
11001             CDS       T01001                                 

Gene name
SLC27A2, ACSVL1, FACVL1, FATP2, HsT17226, VLACS, VLCS, hFACVL1
Definition
(RefSeq) solute carrier family 27 member 2
  KO
K08746  solute carrier family 27 (fatty acid transporter), member 2 [EC:6.2.1.- 6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04146  Peroxisome
hsa04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    11001 (SLC27A2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    11001 (SLC27A2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    11001 (SLC27A2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    11001 (SLC27A2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    11001 (SLC27A2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     11001 (SLC27A2)
    6.2.1.-  
     11001 (SLC27A2)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   11001 (SLC27A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   11001 (SLC27A2)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 11001
NCBI-ProteinID: NP_003636
OMIM: 603247
HGNC: 10996
Ensembl: ENSG00000140284
Vega: OTTHUMG00000131643
Pharos: O14975(Tbio)
UniProt: O14975
LinkDB
Position
15q21.2
AA seq 620 aa
MLSAIYTVLAGLLFLPLLVNLCCPYFFQDIGYFLKVAAVGRRVRSYGKRRPARTILRAFL
EKARQTPHKPFLLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWL
WLGLVKLGCAMACLNYNIRAKSLLHCFQCCGAKVLLVSPELQAAVEEILPSLKKDDVSIY
YVSRTSNTDGIDSFLDKVDEVSTEPIPESWRSEVTFSTPALYIYTSGTTGLPKAAMITHQ
RIWYGTGLTFVSGLKADDVIYITLPFYHSAALLIGIHGCIVAGATLALRTKFSASQFWDD
CRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYE
FYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKG
EVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDR
VGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGK
KLFQHIADYLPSYARPRFLRIQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAK
MYVPMTEDIYNAISAKTLKL
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgctttccgccatctacacagtcctggcgggactgctgttcctgccgctcctggtgaac
ctctgctgcccatacttcttccaggacataggctacttcttgaaggtggccgccgtgggc
cggagggtgcgcagctacgggaagcggcggccggcgcgcaccatcctgcgggcgttcctg
gagaaagcgcgccagacgccacacaagccttttctgctcttccgcgacgagactctcacc
tacgcgcaggtggaccggcgcagcaatcaagtggcccgggcgctgcacgaccacctcggc
ctgcgccagggagactgcgtggcgctccttatgggtaacgagccggcctacgtgtggctg
tggctggggctggtgaagctgggctgtgccatggcgtgcctcaattacaacatccgcgcg
aagtccctgctgcactgcttccagtgctgcggggcgaaggtgctgctggtgtcgccagaa
ctacaagcagctgtcgaagagatactgccaagccttaaaaaagatgatgtgtccatctat
tatgtgagcagaacttctaacacagatgggattgactctttcctggacaaagtggatgaa
gtatcaactgaacctatcccagagtcatggaggtctgaagtcactttttccactcctgcc
ttatacatttatacttctggaaccacaggtcttccaaaagcagccatgatcactcatcag
cgcatatggtatggaactggcctcacttttgtaagcggattgaaggcagatgatgtcatc
tatatcactctgcccttttaccacagtgctgcactactgattggcattcacggatgtatt
gtggctggtgctactcttgccttgcggactaaattttcagccagccagttttgggatgac
tgcagaaaatacaacgtcactgtcattcagtatatcggtgaactgcttcggtatttatgc
aactcaccacagaaaccaaatgaccgtgatcataaagtgagactggcactgggaaatggc
ttacgaggagatgtgtggagacaatttgtcaagagatttggggacatatgcatctatgag
ttctatgctgccactgaaggcaatattggatttatgaattatgcgagaaaagttggtgct
gttggaagagtaaactacctacagaaaaaaatcataacttatgacctgattaaatatgat
gtggagaaagatgaacctgtccgtgatgaaaatggatattgcgtcagagttcccaaaggt
gaagttggacttctggtttgcaaaatcacacaacttacaccatttaatggctatgctgga
gcaaaggctcagacagagaagaaaaaactgagagatgtctttaagaaaggagacctctat
ttcaacagtggagatctcttaatggttgaccatgaaaatttcatctatttccacgacaga
gttggagatacattccggtggaaaggggaaaatgtggccaccactgaagttgctgataca
gttggactggttgattttgtccaagaagtaaatgtttatggagtgcatgtgccagatcat
gagggtcgcattggcatggcctccatcaaaatgaaagaaaaccatgaatttgatggaaag
aaactctttcagcacattgctgattacctacctagttatgcaaggccccggtttctaaga
atacaggacaccattgagatcactggaacttttaaacaccgcaaaatgaccctggtggag
gagggctttaaccctgctgtcatcaaagatgccttgtatttcttggatgacacagcaaaa
atgtatgtgcctatgactgaggacatctataatgccataagtgctaaaaccctgaaactc
tga

KEGG   Homo sapiens (human): 28965
Entry
28965             CDS       T01001                                 

Gene name
SLC27A6, ACSVL2, FACVL2, FATP6, VLCS-H1
Definition
(RefSeq) solute carrier family 27 member 6
  KO
K08749  solute carrier family 27 (fatty acid transporter), member 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    28965 (SLC27A6)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    28965 (SLC27A6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    28965 (SLC27A6)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   28965 (SLC27A6)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 28965
NCBI-ProteinID: NP_001017372
OMIM: 604196
HGNC: 11000
Ensembl: ENSG00000113396
Vega: OTTHUMG00000128991
Pharos: Q9Y2P4(Tbio)
UniProt: Q9Y2P4
LinkDB
Position
5q23.3
AA seq 619 aa
MLLSWLTVLGAGMVVLHFLQKLLFPYFWDDFWFVLKVVLIIIRLKKYEKRGELVTVLDKF
LSHAKRQPRKPFIIYEGDIYTYQDVDKRSSRVAHVFLNHSSLKKGDTVALLMSNEPDFVH
VWFGLAKLGCVVAFLNTNIRSNSLLNCIRACGPRALVVGADLLGTVEEILPSLSENISVW
GMKDSVPQGVISLKEKLSTSPDEPVPRSHHVVSLLKSTCLYIFTSGTTGLPKAAVISQLQ
VLRGSAVLWAFGCTAHDIVYITLPLYHSSAAILGISGCVELGATCVLKKKFSASQFWSDC
KKYDVTVFQYIGELCRYLCKQSKREGEKDHKVRLAIGNGIRSDVWREFLDRFGNIKVCEL
YAATESSISFMNYTGRIGAIGRTNLFYKLLSTFDLIKYDFQKDEPMRNEQGWCIHVKKGE
PGLLISRVNAKNPFFGYAGPYKHTKDKLLCDVFKKGDVYLNTGDLIVQDQDNFLYFWDRT
GDTFRWKGENVATTEVADVIGMLDFIQEANVYGVAISGYEGRAGMASIILKPNTSLDLEK
VYEQVVTFLPAYACPRFLRIQEKMEATGTFKLLKHQLVEDGFNPLKISEPLYFMDNLKKS
YVLLTRELYDQIMLGEIKL
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgcttctgtcatggctaacagttctaggggctggaatggtcgtcctgcacttcttgcag
aaactcctgttcccttacttttgggatgacttctggttcgtgttgaaggtggtgctcatt
ataattcggctgaagaagtatgaaaagagaggggagctggtgactgtgctggataaattc
ttgagtcatgccaaaagacaacctcggaaacctttcatcatctatgagggagacatctac
acctatcaggatgtagacaaaaggagcagcagagtggcccatgtcttcctgaaccattcc
tctctgaaaaagggggacacggtggctctgctgatgagcaatgagccggacttcgttcac
gtgtggttcggcctcgccaagctgggctgcgtggtggcctttctcaacaccaacattcgc
tccaactccctcctgaattgcatccgcgcctgtgggcccagagccctagtggtgggcgca
gatttgcttggaacggtagaagaaatccttccaagcctctcagaaaatatcagtgtttgg
gggatgaaagattctgttccacaaggtgtaatttcactcaaagaaaaactgagcacctca
cctgatgagcccgtgccacgcagccaccatgttgtctcactcctcaagtctacttgtctt
tacatttttacctctggaacaacaggtctaccaaaagcagctgtgattagtcagctgcag
gttttaaggggttctgctgtcctgtgggcttttggttgtactgctcatgacattgtttat
ataacccttcctctgtatcatagttcagcagctatcctgggaatttctggatgtgttgag
ttgggtgccacttgtgtgttaaagaagaaattttcagcaagccagttttggagtgactgc
aagaagtatgatgtgactgtgtttcagtatattggagaactttgtcgctacctttgcaaa
caatctaagagagaaggagaaaaggatcataaggtgcgtttggcaattggaaatggcata
cggagtgatgtatggagagaatttttagacagatttggaaatataaaggtgtgtgaactt
tatgcagctaccgaatcaagcatatctttcatgaactacactgggagaattggagcaatt
gggagaacaaatttgttttacaaacttctttccacttttgacttaataaagtatgacttt
cagaaagatgaacccatgagaaatgagcagggttggtgtattcatgtgaaaaaaggagaa
cctggacttctcatttctcgagtgaatgcaaaaaatcccttctttggctatgctgggcct
tataagcacacaaaagacaaattgctttgtgatgtttttaagaagggagatgtttacctt
aatactggagacttaatagtccaggatcaggacaatttcctttatttttgggaccgtact
ggagacactttcagatggaaaggagaaaatgtcgcaaccactgaggttgctgatgttatt
ggaatgttggatttcatacaggaagcaaacgtctatggtgtggctatatcaggttatgaa
ggaagagcaggaatggcttctattattttaaaaccaaatacatctttagatttggaaaaa
gtttatgaacaagttgtaacatttctaccagcttatgcttgtccacgatttttaagaatt
caggaaaaaatggaagcaacaggaacattcaaactattgaagcatcagttggtggaagat
ggatttaatccactgaaaatttctgaaccactttacttcatggataacttgaaaaagtct
tatgttctactgaccagggaactttatgatcaaataatgttaggggaaataaaactttaa

KEGG   Homo sapiens (human): 376497
Entry
376497            CDS       T01001                                 

Gene name
SLC27A1, ACSVL5, FATP, FATP-1, FATP1
Definition
(RefSeq) solute carrier family 27 member 1
  KO
K08745  solute carrier family 27 (fatty acid transporter), member 1/4 [EC:6.2.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04931  Insulin resistance
hsa04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    376497 (SLC27A1)
  09154 Digestive system
   04975 Fat digestion and absorption
    376497 (SLC27A1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    376497 (SLC27A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    376497 (SLC27A1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    376497 (SLC27A1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     376497 (SLC27A1)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   376497 (SLC27A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   376497 (SLC27A1)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 376497
NCBI-ProteinID: NP_940982
OMIM: 600691
HGNC: 10995
Ensembl: ENSG00000130304
Vega: OTTHUMG00000182878
Pharos: Q6PCB7(Tchem)
UniProt: Q6PCB7
LinkDB
Position
19p13.11
AA seq 646 aa
MRAPGAGAASVVSLALLWLLGLPWTWSAAAALGVYVGSGGWRFLRIVCKTARRDLFGLSV
LIRVRLELRRHQRAGHTIPRIFQAVVQRQPERLALVDAGTGECWTFAQLDAYSNAVANLF
RQLGFAPGDVVAIFLEGRPEFVGLWLGLAKAGMEAALLNVNLRREPLAFCLGTSGAKALI
FGGEMVAAVAEVSGHLGKSLIKFCSGDLGPEGILPDTHLLDPLLKEASTAPLAQIPSKGM
DDRLFYIYTSGTTGLPKAAIVVHSRYYRMAAFGHHAYRMQAADVLYDCLPLYHSAGNIIG
VGQCLIYGLTVVLRKKFSASRFWDDCIKYNCTVVQYIGEICRYLLKQPVREAERRHRVRL
AVGNGLRPAIWEEFTERFGVRQIGEFYGATECNCSIANMDGKVGSCGFNSRILPHVYPIR
LVKVNEDTMELLRDAQGLCIPCQAGEPGLLVGQINQQDPLRRFDGYVSESATSKKIAHSV
FSKGDSAYLSGDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEGVLSRLLGQTDVAVY
GVAVPGVEGKAGMAAVADPHSLLDPNAIYQELQKVLAPYARPIFLRLLPQVDTTGTFKIQ
KTRLQREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSGAFAL
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgcgggctccgggtgcgggcgcggcctcggtggtctcgctggcgctgttgtggctgctg
gggctgccgtggacctggagcgcggcagcggcgctcggcgtgtacgtgggcagcggcggc
tggcgcttcctgcgcatcgtctgcaagaccgcgaggcgagacctcttcggtctctctgtg
ctgatccgcgtgcgcctggagctgcggcggcaccagcgtgccggccacaccatcccgcgc
atctttcaggcggtagtgcagcgacagcccgagcgcctggcgctggtggatgccgggacc
ggcgagtgctggacctttgcgcagctggacgcctactccaatgcggtagccaacctcttc
cgccagctgggcttcgcgccgggcgacgtggtggccatcttcctggagggccggccggag
ttcgtggggctgtggctgggcctggccaaggcgggcatggaggccgcgctgctcaacgtg
aacctgcggcgcgagcccctggccttctgcctgggcacctcgggcgctaaggccctgatc
tttggaggagaaatggtggcggcggtggccgaagtgagcgggcatctggggaaaagtttg
atcaagttctgctctggagacttggggcccgagggcatcttgccggacacccacctcctg
gacccgctgctgaaggaggcctctactgcccccttggcacagatccccagcaagggcatg
gacgatcgtcttttctacatctacacgtcggggaccaccgggctgcccaaggctgccatt
gtcgtgcacagcaggtactaccgcatggcagccttcggccaccacgcctaccgcatgcag
gcggctgacgtgctctatgactgcctgcccctgtaccactcggcaggaaacatcatcggc
gtggggcagtgtctcatctatgggctgacagtcgtcctccgcaagaaattctcggccagc
cgcttctgggacgactgcatcaagtacaactgcacggtggttcagtacatcggggagatc
tgccgctacctgctgaagcagccggtgcgcgaggcggagaggcgacaccgcgtgcgcctg
gcggtggggaacgggctgcgtcctgccatctgggaggagttcacggagcgcttcggcgta
cgccaaatcggggagttctacggcgccaccgagtgcaactgcagcattgccaacatggac
ggcaaggtcggctcctgtggtttcaacagccgcatcctgccccacgtgtaccccatccgg
ctggtgaaggtcaatgaggacacaatggagctgctgcgggatgcccagggcctctgcatc
ccctgccaggccggggagcctggcctccttgtgggtcagatcaaccaacaggacccgctg
cgccgcttcgatggctatgtcagcgagagcgccaccagcaagaagatcgcccacagcgtc
ttcagcaagggcgacagcgcctacctctcaggtgacgtgctagtgatggatgagctgggc
tacatgtacttccgggaccgtagcggggacaccttccgctggcgaggggagaacgtctcc
accaccgaggtggagggcgtgctgagccgcctgctgggccagacagacgtggccgtctat
ggggtggctgttccaggagtggagggtaaggcagggatggcggccgtcgcagacccccac
agcctgctggaccccaacgcgatataccaggagctgcagaaggtgctggcaccctatgcc
cggcccatcttcctgcgcctcctgccccaggtggacaccacaggcaccttcaagatccag
aagacgaggctgcagcgagagggctttgacccacgccagacctcagaccggctcttcttc
ctggacctgaagcagggccactacctgcccttaaatgaggcagtctacactcgcatctgc
tcgggcgccttcgccctctga

DBGET integrated database retrieval system