KEGG   Homo sapiens (human): 10999
Entry
10999             CDS       T01001                                 

Gene name
SLC27A4, ACSVL4, FATP4, IPS
Definition
(RefSeq) solute carrier family 27 member 4
  KO
K08745  solute carrier family 27 (fatty acid transporter), member 1/4 [EC:6.2.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04931  Insulin resistance
hsa04975  Fat digestion and absorption
Disease
H00741  Ichthyosis prematurity syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    10999 (SLC27A4)
  09154 Digestive system
   04975 Fat digestion and absorption
    10999 (SLC27A4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    10999 (SLC27A4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    10999 (SLC27A4)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    10999 (SLC27A4)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     10999 (SLC27A4)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   10999 (SLC27A4)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   10999 (SLC27A4)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 10999
NCBI-ProteinID: NP_005085
OMIM: 604194
HGNC: 10998
Ensembl: ENSG00000167114
Vega: OTTHUMG00000020746
Pharos: Q6P1M0(Tchem)
UniProt: Q6P1M0 A0A024R8D2
LinkDB
Position
9q34.11
AA seq 643 aa
MLLGASLVGVLLFSKLVLKLPWTQVGFSLLFLYLGSGGWRFIRVFIKTIRRDIFGGLVLL
KVKAKVRQCLQERRTVPILFASTVRRHPDKTALIFEGTDTHWTFRQLDEYSSSVANFLQA
RGLASGDVAAIFMENRNEFVGLWLGMAKLGVEAALINTNLRRDALLHCLTTSRARALVFG
SEMASAICEVHASLDPSLSLFCSGSWEPGAVPPSTEHLDPLLKDAPKHLPSCPDKGFTDK
LFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGFRMRPNDIVYDCLPLYHSAGNIVGIGQ
CLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYLLNQPPREAENQHQVRMALG
NGLRQSIWTNFSSRFHIPQVAEFYGATECNCSLGNFDSQVGACGFNSRILSFVYPIRLVR
VNEDTMELIRGPDGVCIPCQPGEPGQLVGRIIQKDPLRRFDGYLNQGANNKKIAKDVFKK
GDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVE
VPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTE
LRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgctgcttggagcctctctggtgggggtgctgctgttctccaagctggtgctgaaactg
ccctggacccaggtgggattctccctgttgttcctctacttgggatctggcggctggcgc
ttcatccgggtcttcatcaagaccatcaggcgcgatatctttggcggcctggtcctcctg
aaggtgaaggcaaaggtgcgacagtgcctgcaggagcggcggacagtgcccattttgttt
gcctctaccgttcggcgccaccccgacaagacggccctgatcttcgagggcacagatacc
cactggaccttccgccagctggatgagtactcaagcagtgtagccaacttcctgcaggcc
cggggcctggcctcgggcgatgtggctgccatcttcatggagaaccgcaatgagttcgtg
ggcctatggctgggcatggccaagctcggtgtggaggcagccctcatcaacaccaacctg
cggcgggatgctctgctccactgcctcaccacctcgcgcgcacgggcccttgtctttggc
agcgaaatggcctcagccatctgtgaggtccatgccagcctggacccctcgctcagcctc
ttctgctctggctcctgggagcccggtgcggtgcctccaagcacagaacacctggaccct
ctgctgaaagatgctcccaagcaccttcccagttgccctgacaagggcttcacagataaa
ctgttctacatctacacatccggcaccacagggctgcccaaggccgccatcgtggtgcac
agcaggtattaccgcatggctgccctggtgtactatggattccgcatgcggcccaacgac
atcgtctatgactgcctccccctctaccactcagcaggaaacatcgtgggaatcggccag
tgcctgctgcatggcatgacggtggtgattcggaagaagttctcagcctcccggttctgg
gacgattgtatcaagtacaactgcacgattgtgcagtacattggtgaactgtgccgctac
ctcctgaaccagccaccgcgggaggcagaaaaccagcaccaggttcgcatggcactaggc
aatggcctccggcagtccatctggaccaacttttccagccgcttccacataccccaggtg
gctgagttctacggggccacagagtgcaactgtagcctgggcaacttcgacagccaggtg
ggggcctgtggtttcaatagccgcatcctgtccttcgtgtaccccatccggttggtacgt
gtcaacgaggacaccatggagctgatccgggggcccgacggcgtctgcattccctgccag
ccaggtgagccgggccagctggtgggccgcatcatccagaaagaccccctgcgccgcttc
gatggctacctcaaccagggcgccaacaacaagaagattgccaaggatgtcttcaagaag
ggggaccaggcctaccttactggtgatgtgctggtgatggacgagctgggctacctgtac
ttccgagaccgcactggggacacgttccgctggaaaggtgagaacgtgtccaccaccgag
gtggaaggcacactcagccgcctgctggacatggctgacgtggccgtgtatggtgtcgag
gtgccaggaaccgagggccgggccggaatggctgctgtggccagccccactggcaactgt
gacctggagcgctttgctcaggtcttggagaaggaactgcccctgtatgcgcgccccatc
ttcctgcgcctcctgcctgagctgcacaaaacaggaacctacaagttccagaagacagag
ctacggaaggagggctttgacccggctattgtgaaagacccgctgttctatctagatgcc
cagaagggccgctacgtcccgctggaccaagaggcctacagccgcatccaggcaggcgag
gagaagctgtga

KEGG   Homo sapiens (human): 376497
Entry
376497            CDS       T01001                                 

Gene name
SLC27A1, ACSVL5, FATP, FATP-1, FATP1
Definition
(RefSeq) solute carrier family 27 member 1
  KO
K08745  solute carrier family 27 (fatty acid transporter), member 1/4 [EC:6.2.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04931  Insulin resistance
hsa04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    376497 (SLC27A1)
  09154 Digestive system
   04975 Fat digestion and absorption
    376497 (SLC27A1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    376497 (SLC27A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    376497 (SLC27A1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    376497 (SLC27A1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     376497 (SLC27A1)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   376497 (SLC27A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   376497 (SLC27A1)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 376497
NCBI-ProteinID: NP_940982
OMIM: 600691
HGNC: 10995
Ensembl: ENSG00000130304
Vega: OTTHUMG00000182878
Pharos: Q6PCB7(Tchem)
UniProt: Q6PCB7
LinkDB
Position
19p13.11
AA seq 646 aa
MRAPGAGAASVVSLALLWLLGLPWTWSAAAALGVYVGSGGWRFLRIVCKTARRDLFGLSV
LIRVRLELRRHQRAGHTIPRIFQAVVQRQPERLALVDAGTGECWTFAQLDAYSNAVANLF
RQLGFAPGDVVAIFLEGRPEFVGLWLGLAKAGMEAALLNVNLRREPLAFCLGTSGAKALI
FGGEMVAAVAEVSGHLGKSLIKFCSGDLGPEGILPDTHLLDPLLKEASTAPLAQIPSKGM
DDRLFYIYTSGTTGLPKAAIVVHSRYYRMAAFGHHAYRMQAADVLYDCLPLYHSAGNIIG
VGQCLIYGLTVVLRKKFSASRFWDDCIKYNCTVVQYIGEICRYLLKQPVREAERRHRVRL
AVGNGLRPAIWEEFTERFGVRQIGEFYGATECNCSIANMDGKVGSCGFNSRILPHVYPIR
LVKVNEDTMELLRDAQGLCIPCQAGEPGLLVGQINQQDPLRRFDGYVSESATSKKIAHSV
FSKGDSAYLSGDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEGVLSRLLGQTDVAVY
GVAVPGVEGKAGMAAVADPHSLLDPNAIYQELQKVLAPYARPIFLRLLPQVDTTGTFKIQ
KTRLQREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSGAFAL
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgcgggctccgggtgcgggcgcggcctcggtggtctcgctggcgctgttgtggctgctg
gggctgccgtggacctggagcgcggcagcggcgctcggcgtgtacgtgggcagcggcggc
tggcgcttcctgcgcatcgtctgcaagaccgcgaggcgagacctcttcggtctctctgtg
ctgatccgcgtgcgcctggagctgcggcggcaccagcgtgccggccacaccatcccgcgc
atctttcaggcggtagtgcagcgacagcccgagcgcctggcgctggtggatgccgggacc
ggcgagtgctggacctttgcgcagctggacgcctactccaatgcggtagccaacctcttc
cgccagctgggcttcgcgccgggcgacgtggtggccatcttcctggagggccggccggag
ttcgtggggctgtggctgggcctggccaaggcgggcatggaggccgcgctgctcaacgtg
aacctgcggcgcgagcccctggccttctgcctgggcacctcgggcgctaaggccctgatc
tttggaggagaaatggtggcggcggtggccgaagtgagcgggcatctggggaaaagtttg
atcaagttctgctctggagacttggggcccgagggcatcttgccggacacccacctcctg
gacccgctgctgaaggaggcctctactgcccccttggcacagatccccagcaagggcatg
gacgatcgtcttttctacatctacacgtcggggaccaccgggctgcccaaggctgccatt
gtcgtgcacagcaggtactaccgcatggcagccttcggccaccacgcctaccgcatgcag
gcggctgacgtgctctatgactgcctgcccctgtaccactcggcaggaaacatcatcggc
gtggggcagtgtctcatctatgggctgacagtcgtcctccgcaagaaattctcggccagc
cgcttctgggacgactgcatcaagtacaactgcacggtggttcagtacatcggggagatc
tgccgctacctgctgaagcagccggtgcgcgaggcggagaggcgacaccgcgtgcgcctg
gcggtggggaacgggctgcgtcctgccatctgggaggagttcacggagcgcttcggcgta
cgccaaatcggggagttctacggcgccaccgagtgcaactgcagcattgccaacatggac
ggcaaggtcggctcctgtggtttcaacagccgcatcctgccccacgtgtaccccatccgg
ctggtgaaggtcaatgaggacacaatggagctgctgcgggatgcccagggcctctgcatc
ccctgccaggccggggagcctggcctccttgtgggtcagatcaaccaacaggacccgctg
cgccgcttcgatggctatgtcagcgagagcgccaccagcaagaagatcgcccacagcgtc
ttcagcaagggcgacagcgcctacctctcaggtgacgtgctagtgatggatgagctgggc
tacatgtacttccgggaccgtagcggggacaccttccgctggcgaggggagaacgtctcc
accaccgaggtggagggcgtgctgagccgcctgctgggccagacagacgtggccgtctat
ggggtggctgttccaggagtggagggtaaggcagggatggcggccgtcgcagacccccac
agcctgctggaccccaacgcgatataccaggagctgcagaaggtgctggcaccctatgcc
cggcccatcttcctgcgcctcctgccccaggtggacaccacaggcaccttcaagatccag
aagacgaggctgcagcgagagggctttgacccacgccagacctcagaccggctcttcttc
ctggacctgaagcagggccactacctgcccttaaatgaggcagtctacactcgcatctgc
tcgggcgccttcgccctctga

DBGET integrated database retrieval system