KEGG   Homo sapiens (human): 11001
Entry
11001             CDS       T01001                                 

Gene name
SLC27A2, ACSVL1, FACVL1, FATP2, HsT17226, VLACS, VLCS, hFACVL1
Definition
(RefSeq) solute carrier family 27 member 2
  KO
K08746  solute carrier family 27 (fatty acid transporter), member 2 [EC:6.2.1.- 6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04146  Peroxisome
hsa04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    11001 (SLC27A2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    11001 (SLC27A2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    11001 (SLC27A2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    11001 (SLC27A2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    11001 (SLC27A2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     11001 (SLC27A2)
    6.2.1.-  
     11001 (SLC27A2)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   11001 (SLC27A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   11001 (SLC27A2)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 11001
NCBI-ProteinID: NP_003636
OMIM: 603247
HGNC: 10996
Ensembl: ENSG00000140284
Vega: OTTHUMG00000131643
Pharos: O14975(Tbio)
UniProt: O14975
LinkDB
Position
15q21.2
AA seq 620 aa
MLSAIYTVLAGLLFLPLLVNLCCPYFFQDIGYFLKVAAVGRRVRSYGKRRPARTILRAFL
EKARQTPHKPFLLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWL
WLGLVKLGCAMACLNYNIRAKSLLHCFQCCGAKVLLVSPELQAAVEEILPSLKKDDVSIY
YVSRTSNTDGIDSFLDKVDEVSTEPIPESWRSEVTFSTPALYIYTSGTTGLPKAAMITHQ
RIWYGTGLTFVSGLKADDVIYITLPFYHSAALLIGIHGCIVAGATLALRTKFSASQFWDD
CRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYE
FYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKG
EVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDR
VGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGK
KLFQHIADYLPSYARPRFLRIQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAK
MYVPMTEDIYNAISAKTLKL
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgctttccgccatctacacagtcctggcgggactgctgttcctgccgctcctggtgaac
ctctgctgcccatacttcttccaggacataggctacttcttgaaggtggccgccgtgggc
cggagggtgcgcagctacgggaagcggcggccggcgcgcaccatcctgcgggcgttcctg
gagaaagcgcgccagacgccacacaagccttttctgctcttccgcgacgagactctcacc
tacgcgcaggtggaccggcgcagcaatcaagtggcccgggcgctgcacgaccacctcggc
ctgcgccagggagactgcgtggcgctccttatgggtaacgagccggcctacgtgtggctg
tggctggggctggtgaagctgggctgtgccatggcgtgcctcaattacaacatccgcgcg
aagtccctgctgcactgcttccagtgctgcggggcgaaggtgctgctggtgtcgccagaa
ctacaagcagctgtcgaagagatactgccaagccttaaaaaagatgatgtgtccatctat
tatgtgagcagaacttctaacacagatgggattgactctttcctggacaaagtggatgaa
gtatcaactgaacctatcccagagtcatggaggtctgaagtcactttttccactcctgcc
ttatacatttatacttctggaaccacaggtcttccaaaagcagccatgatcactcatcag
cgcatatggtatggaactggcctcacttttgtaagcggattgaaggcagatgatgtcatc
tatatcactctgcccttttaccacagtgctgcactactgattggcattcacggatgtatt
gtggctggtgctactcttgccttgcggactaaattttcagccagccagttttgggatgac
tgcagaaaatacaacgtcactgtcattcagtatatcggtgaactgcttcggtatttatgc
aactcaccacagaaaccaaatgaccgtgatcataaagtgagactggcactgggaaatggc
ttacgaggagatgtgtggagacaatttgtcaagagatttggggacatatgcatctatgag
ttctatgctgccactgaaggcaatattggatttatgaattatgcgagaaaagttggtgct
gttggaagagtaaactacctacagaaaaaaatcataacttatgacctgattaaatatgat
gtggagaaagatgaacctgtccgtgatgaaaatggatattgcgtcagagttcccaaaggt
gaagttggacttctggtttgcaaaatcacacaacttacaccatttaatggctatgctgga
gcaaaggctcagacagagaagaaaaaactgagagatgtctttaagaaaggagacctctat
ttcaacagtggagatctcttaatggttgaccatgaaaatttcatctatttccacgacaga
gttggagatacattccggtggaaaggggaaaatgtggccaccactgaagttgctgataca
gttggactggttgattttgtccaagaagtaaatgtttatggagtgcatgtgccagatcat
gagggtcgcattggcatggcctccatcaaaatgaaagaaaaccatgaatttgatggaaag
aaactctttcagcacattgctgattacctacctagttatgcaaggccccggtttctaaga
atacaggacaccattgagatcactggaacttttaaacaccgcaaaatgaccctggtggag
gagggctttaaccctgctgtcatcaaagatgccttgtatttcttggatgacacagcaaaa
atgtatgtgcctatgactgaggacatctataatgccataagtgctaaaaccctgaaactc
tga

DBGET integrated database retrieval system