KEGG   Homo sapiens (human): 11009Help
Entry
11009             CDS       T01001                                 

Gene name
IL24, C49A, FISP, IL10B, MDA7, MOB5, ST16
Definition
(RefSeq) interleukin 24
  KO
K22668  interleukin 24
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    11009 (IL24)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    11009 (IL24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    11009 (IL24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    11009 (IL24)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   11009 (IL24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL22 IL10
Motif
Other DBs
NCBI-GeneID: 11009
NCBI-ProteinID: NP_006841
OMIM: 604136
HGNC: 11346
Ensembl: ENSG00000162892
Vega: OTTHUMG00000036459
Pharos: Q13007(Tbio)
UniProt: Q13007
LinkDB All DBs
Structure
PDB: 

Position
1q32.1
AA seq 206 aa AA seqDB search
MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQ
VKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTV
FKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL
DVEAALTKALGEVDILLTWMQKFYKL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaattttcaacagaggctgcaaagcctgtggactttagccagacccttctgccctcct
ttgctggcgacagcctctcaaatgcagatggttgtgctcccttgcctgggttttaccctg
cttctctggagccaggtatcaggggcccagggccaagaattccactttgggccctgccaa
gtgaagggggttgttccccagaaactgtgggaagccttctgggctgtgaaagacactatg
caagctcaggataacatcacgagtgcccggctgctgcagcaggaggttctgcagaacgtc
tcggatgctgagagctgttaccttgtccacaccctgctggagttctacttgaaaactgtt
ttcaaaaactaccacaatagaacagttgaagtcaggactctgaagtcattctctactctg
gccaacaactttgttctcatcgtgtcacaactgcaacccagtcaagaaaatgagatgttt
tccatcagagacagtgcacacaggcggtttctgctattccggagagcattcaaacagttg
gacgtagaagcagctctgaccaaagcccttggggaagtggacattcttctgacctggatg
cagaaattctacaagctctga

DBGET integrated database retrieval system