KEGG   Homo sapiens (human): 1101Help
Entry
1101              CDS       T01001                                 

Gene name
CHAD, SLRR4A
Definition
(RefSeq) chondroadherin
  KO
K06248  chondroadherin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    1101 (CHAD)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    1101 (CHAD)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    1101 (CHAD)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    1101 (CHAD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    1101 (CHAD)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class IV
    1101 (CHAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_1 LRRNT LRR_9 LRRCT
Motif
Other DBs
NCBI-GeneID: 1101
NCBI-ProteinID: NP_001258
OMIM: 602178
HGNC: 1909
Ensembl: ENSG00000136457
Vega: OTTHUMG00000162129
Pharos: O15335(Tdark)
UniProt: O15335
LinkDB All DBs
Structure
PDB: 

Position
17q21.33
AA seq 359 aa AA seqDB search
MVRPMLLLSLGLLAGLLPALAACPQNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQR
NNFPVLAANSFRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFD
DLTELTYLYLDHNKVTELPRGLLSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSE
NALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQ
SFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPSNFPFDSLETLALTNN
PWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCKFPTKRSKKAGRH
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggtccgcccaatgctcttgctcagcctcggcctcctggctggtctgctgccggcgctg
gccgcctgcccccagaactgccactgccacagcgacctgcagcacgtcatctgcgacaag
gtggggctgcagaagatccccaaggtgtcagagaagaccaagctgctcaacctacagcgc
aacaacttcccggtgctggctgccaattcgttccgggccatgccgaacctcgtgtcattg
cacctgcagcactgccagatccgcgaggtggccgccggtgccttccgcggcctcaagcaa
cttatctacttgtacctgtcccataacgacatccgcgtgctgcgcgcaggtgccttcgac
gacctgaccgagctgacctacctctacctggaccacaacaaggtcactgagctgccccgg
gggttgctctccccgctggtcaacctcttcatcttgcagctcaacaacaacaagatccgt
gagctgcgcgcaggcgccttccagggagccaaggacctgcgctggctctacctgtcggaa
aacgcgttgagctccctgcagcccggggccctggacgacgtggagaacctcgccaaattc
cacgtggacaggaaccagctgtccagctacccctcagctgccctgagcaagctacgggtg
gtggaggagctgaagctgtcccacaaccccctgaaaagcatcccggacaatgccttccag
tcctttggcagatacctggagaccctctggctggacaacaccaacctggagaagttctca
gatggtgccttcctgggtgtaaccacgctgaaacacgtccatttggagaacaaccgcttg
aaccagctaccctccaacttccccttcgacagcctggagaccctcgcccttaccaataac
ccctggaagtgtacctgccagctccggggccttcggcggtggctggaagccaaggcctcc
cgcccagatgccacctgtgcctcacctgccaagttcaagggccagcacatccgtgacacg
gacgccttccgcagctgcaagttccccaccaagaggtccaagaaagctggccgccattaa

DBGET integrated database retrieval system