KEGG   Homo sapiens (human): 11021Help
Entry
11021             CDS       T01001                                 

Gene name
RAB35, H-ray, RAB1C, RAY
Definition
(RefSeq) RAB35, member RAS oncogene family
  KO
K07876  Ras-related protein Rab-35
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    11021 (RAB35)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    11021 (RAB35)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    11021 (RAB35)
   04031 GTP-binding proteins [BR:hsa04031]
    11021 (RAB35)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    11021 (RAB35)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   11021 (RAB35)
  Exosomal proteins of other body fluids (saliva and urine)
   11021 (RAB35)
  Exosomal proteins of colorectal cancer cells
   11021 (RAB35)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab1/35 [OT]
    11021 (RAB35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase PduV-EutP SRPRB AAA_22 AAA_16 AAA AAA_29 AAA_24 MCM TniB AAA_5 Dioxygenase_N NACHT AAA_23 ABC_tran
Motif
Other DBs
NCBI-GeneID: 11021
NCBI-ProteinID: NP_006852
OMIM: 604199
HGNC: 9774
Ensembl: ENSG00000111737
Vega: OTTHUMG00000169159
Pharos: Q15286(Tbio)
UniProt: Q15286
LinkDB All DBs
Structure
PDB: 

Position
12q24.23
AA seq 201 aa AA seqDB search
MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQ
IWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGN
KNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQ
QQQQNDVVKLTKNSKRKKRCC
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcccgggactacgaccacctcttcaagctgctcatcatcggcgacagcggtgtgggc
aagagcagtttactgttgcgttttgcagacaacactttctcaggcagctacatcaccacg
atcggagtggatttcaagatccggaccgtggagatcaacggggagaaggtgaagctgcag
atctgggacacagcggggcaggagcgcttccgcaccatcacctccacgtattatcggggg
acccacggggtcattgtggtttacgacgtcaccagtgccgagtcctttgtcaacgtcaag
cggtggcttcacgaaatcaaccagaactgtgatgatgtgtgccgaatattagtgggtaat
aagaatgacgaccctgagcggaaggtggtggagacggaagatgcctacaaattcgccggg
cagatgggcatccagttgttcgagaccagcgccaaggagaatgtcaacgtggaagagatg
ttcaactgcatcacggagctggtcctccgagcaaagaaagacaacctggcaaaacagcag
cagcaacaacagaacgatgtggtgaagctcacgaagaacagtaaacgaaagaaacgctgc
tgctaa

DBGET integrated database retrieval system