KEGG   Homo sapiens (human): 11036Help
Entry
11036             CDS       T01001                                 

Gene name
GTF2A1L, ALF
Definition
(RefSeq) general transcription factor IIA subunit 1 like
  KO
K03122  transcription initiation factor TFIIA large subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    11036 (GTF2A1L)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    11036 (GTF2A1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    11036 (GTF2A1L)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIA
     11036 (GTF2A1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIA
Motif
Other DBs
NCBI-GeneID: 11036
NCBI-ProteinID: NP_006863
OMIM: 605358
HGNC: 30727
Ensembl: ENSG00000242441
Vega: OTTHUMG00000152038
Pharos: Q9UNN4(Tbio)
UniProt: Q9UNN4 A0A140VKA3
LinkDB All DBs
Position
2p16.3
AA seq 478 aa AA seqDB search
MACLNPVPKLYRSVIEDVIEGVRNLFAEEGIEEQVLKDLKQLWETKVLQSKATEDFFRNS
IQSPLFTLQLPHSLHQTLQSSTASLVIPAGRTLPSFTTAELGTSNSSANFTFPGYPIHVP
AGVTLQTVSGHLYKVNVPIMVTETSGRAGILQHPIQQVFQQLGQPSVIQTSVPQLNPWSL
QATTEKSQRIETVLQQPAILPSGPVDRKHLENATSDILVSPGNEHKIVPEALLCHQESSH
YISLPGVVFSPQVSQTNSNVESVLSGSASMAQNLHDESLSTSPHGALHQHVTDIQLHILK
NRMYGCDSVKQPRNIEEPSNIPVSEKDSNSQVDLSIRVTDDDIGEIIQVDGSGDTSSNEE
IGSTRDADENEFLGNIDGGDLKVPEEEADSISNEDSATNSSDNEDPQVNIVEEDPLNSGD
DVSEQDVPDLFDTDNVIVCQYDKIHRSKNKWKFYLKDGVMCFGGRDYVFAKAIGDAEW
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcctgcctcaacccggtgcctaaactctacagatctgtaattgaagatgtaattgaa
ggagttcggaatctatttgctgaagaaggtatagaggaacaagttttaaaagacttgaag
cagctctgggaaaccaaggttttgcagtctaaagcaacagaagacttcttcagaaatagc
atccaatcacctctgtttactcttcagttgccgcacagcttgcaccaaacattgcaatcg
tcaacagcatcattagttattcctgctggtagaactcttccaagttttaccacagcagaa
ctgggcacttcaaactccagtgcaaactttacttttcctggttatcccattcatgtacca
gcaggtgtgacactacagactgtatctggtcacctttataaagtcaatgtaccaattatg
gtgacagagacttctggaagagcaggtattcttcagcatccaattcagcaagtatttcaa
cagcttggccagccttcagtaatacaaactagtgttccacaattgaatccatggtctctt
caagcaactactgaaaaatcacagagaattgaaaccgtgctacagcaacccgcaattcta
ccttctgggccagtagataggaaacacttagaaaatgccaccagtgatatacttgtatct
cctggaaatgagcataaaatcgtgcctgaagctttgttgtgtcatcaggaaagttctcac
tatatcagtcttccaggtgttgtattttctccacaggtctctcaaacaaattctaatgtg
gagtcagtgctcagtggttcagctagcatggctcaaaatctgcatgatgagtccctctcc
acaagccctcatggggctctccaccagcacgtgactgatattcagcttcatattcttaaa
aataggatgtatggatgtgattctgtaaagcaaccaagaaatatagaggaacccagcaac
atacctgtatcagagaaggattctaattctcaggtggatttaagcattcgggttactgat
gatgatattggtgaaataattcaagtagatggaagcggtgatacatcttccaatgaagaa
ataggaagtacaagagatgcagatgagaatgaatttctagggaatattgacgggggagat
ctgaaggtacctgaagaagaagctgacagtatttcaaatgaggattcagccacaaacagt
agtgataatgaagaccctcaagtaaacattgtagaagaggaccctttaaattctggagat
gatgttagtgaacaggatgtgccagacctgtttgacacggataatgttattgtctgtcag
tatgataagattcatcgaagcaagaacaaatggaaattctatttgaaagatggtgttatg
tgttttggagggagagactatgtatttgcaaaagccattggtgatgcagagtggtaa

KEGG   Homo sapiens (human): 2957Help
Entry
2957              CDS       T01001                                 

Gene name
GTF2A1, TF2A1, TFIIA, TFIIA-42, TFIIAL
Definition
(RefSeq) general transcription factor IIA subunit 1
  KO
K03122  transcription initiation factor TFIIA large subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    2957 (GTF2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    2957 (GTF2A1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    2957 (GTF2A1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIA
     2957 (GTF2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIA SelP_N
Motif
Other DBs
NCBI-GeneID: 2957
NCBI-ProteinID: NP_056943
OMIM: 600520
HGNC: 4646
Ensembl: ENSG00000165417
Vega: OTTHUMG00000171414
Pharos: P52655(Tbio)
UniProt: P52655
LinkDB All DBs
Structure
PDB: 

Position
14q31.1
AA seq 376 aa AA seqDB search
MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFH
SEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIV
PDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQ
SVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTV
AAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKE
KDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNL
NGRDYIFSKAIGDAEW
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcgaactcggcaaatacaaacaccgtgcctaaattatacagatctgtgattgaagat
gtcattaatgatgtgagagacatctttctggatgatggagtggatgaacaagtactgatg
gaactaaaaactttatgggaaaacaaactaatgcagtccagggcagtagatggatttcat
tcagaagagcagcagcttctactgcaagttcaacagcagcatcaaccccagcagcagcag
catcaccaccatcaccatcatcagcaagctcagcctcagcagacagtacctcagcaagcg
cagacccagcaggttcttattcctgcatcacagcaagccacagcaccacaagttattgtt
ccagattctaagttgatacagcatatgaatgcatcaaacatgagtgctgctgctacagct
gctaccttagcactccctgcaggtgtgactcctgttcagcagatattaacaaattcaggc
cagcttcttcaggtggtcagagcagccaatggtgcccaatatatctttcagcctcagcag
tcagtggttctacaacaacaggttataccacaaatgcagcctggtggagtacaagctcct
gttatacagcaggtgctggctcctcttcctggagggatttcaccacagacaggtgtcatc
atccagcctcagcaaatcttatttacaggaaataagactcaagttatacctacgacagtg
gcagcacctacaccagcccaagcacagataactgcaactggccagcagcaaccgcaggcc
cagcctgctcaaacacaagctccattggtcttacaagttgatggaactggggatacatca
tctgaagaagatgaagatgaagaagaagactatgatgatgatgaggaggaagacaaagag
aaagatggagctgaagatgggcaggtggaagaagagcccctcaatagtgaagatgatgtg
agtgatgaggaaggacaggaactctttgacacagaaaatgttgttgtatgccaatatgat
aagatacacagaagtaaaaacaaatggaaatttcatctcaaggatggcattatgaatctt
aatggaagagattatatattttccaaagccattggagatgcagaatggtga

KEGG   Homo sapiens (human): 2958Help
Entry
2958              CDS       T01001                                 

Gene name
GTF2A2, HsT18745, T18745, TF2A2, TFIIA, TFIIA-12, TFIIA-gamma, TFIIAS
Definition
(RefSeq) general transcription factor IIA subunit 2
  KO
K03123  transcription initiation factor TFIIA small subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    2958 (GTF2A2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    2958 (GTF2A2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    2958 (GTF2A2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIA
     2958 (GTF2A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIA_gamma_N TFIIA_gamma_C
Motif
Other DBs
NCBI-GeneID: 2958
NCBI-ProteinID: NP_001307858
OMIM: 600519
HGNC: 4647
Ensembl: ENSG00000140307
Vega: OTTHUMG00000132725
Pharos: P52657(Tbio)
UniProt: P52657 A0A024R5Z5
LinkDB All DBs
Structure
PDB: 

Position
15q22.2
AA seq 109 aa AA seqDB search
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRG
SLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcagttatacagaaatactactttgggaaacagtcttcaggagagcctagat
gagctcatacagtctcaacagatcaccccccaacttgcccttcaagttctacttcagttt
gataaggctataaatgcagcactggctcagagggtcaggaacagagtcaatttcaggggc
tctctaaatacgtacagattctgcgataatgtgtggacttttgtactgaatgatgttgaa
ttcagagaggtgacagaacttattaaagtggataaagtgaaaattgtagcctgtgatggt
aaaaatactggctccaatactacagaatga

DBGET integrated database retrieval system