KEGG   Homo sapiens (human): 11040Help
Entry
11040             CDS       T01001                                 

Gene name
PIM2
Definition
(RefSeq) Pim-2 proto-oncogene, serine/threonine kinase
  KO
K08806  proto-oncogene serine/threonine-protein kinase Pim-2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05200  Pathways in cancer
hsa05221  Acute myeloid leukemia
Network
nt06219  JAK-STAT signaling
nt06275  Acute myeloid leukemia
  Element
N00054  Duplication or mutation-activated FLT3 to Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11040 (PIM2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    11040 (PIM2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    11040 (PIM2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     11040 (PIM2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   11040 (PIM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 11040
NCBI-ProteinID: NP_006866
OMIM: 300295
HGNC: 8987
Ensembl: ENSG00000102096
Vega: OTTHUMG00000024132
Pharos: Q9P1W9(Tchem)
UniProt: Q9P1W9 A0A024QYW7
LinkDB All DBs
Structure
PDB: 

Position
Xp11.23
AA seq 311 aa AA seqDB search
MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccaagcctctacaggggcctcccgcgccccccgggacccccacgccgccgcca
ggaggcaaggatcgggaagcgttcgaggccgagtatcgactcggccccctcctgggtaag
gggggctttggcaccgtcttcgcaggacaccgcctcacagatcgactccaggtggccatc
aaagtgattccccggaatcgtgtgctgggctggtcccccttgtcagactcagtcacatgc
ccactcgaagtcgcactgctatggaaagtgggtgcaggtggtgggcaccctggcgtgatc
cgcctgcttgactggtttgagacacaggagggcttcatgctggtcctcgagcggcctttg
cccgcccaggatctctttgactatatcacagagaagggcccactgggtgaaggcccaagc
cgctgcttctttggccaagtagtggcagccatccagcactgccattcccgtggagttgtc
catcgtgacatcaaggatgagaacatcctgatagacctacgccgtggctgtgccaaactc
attgattttggttctggtgccctgcttcatgatgaaccctacactgactttgatgggaca
agggtgtacagccccccagagtggatctctcgacaccagtaccatgcactcccggccact
gtctggtcactgggcatcctcctctatgacatggtgtgtggggacattccctttgagagg
gaccaggagattctggaagctgagctccacttcccagcccatgtctccccagactgctgt
gccctaatccgccggtgcctggcccccaaaccttcttcccgaccctcactggaagagatc
ctgctggacccctggatgcaaacaccagccgaggatgtacccctcaacccctccaaagga
ggccctgcccctttggcctggtccttgctaccctaa

DBGET integrated database retrieval system