KEGG   Homo sapiens (human): 11149
Entry
11149             CDS       T01001                                 

Gene name
BVES, CARICK, HBVES, LGMD2X, LGMDR25, POP1, POPDC1
Definition
(RefSeq) blood vessel epicardial substance
  KO
K21108  blood vessel epicardial substance
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
Disease
H00593  Limb-girdle muscular dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    11149 (BVES)
SSDB
Motif
Pfam: Popeye cNMP_binding DUF4070
Other DBs
NCBI-GeneID: 11149
NCBI-ProteinID: NP_001186492
OMIM: 604577
HGNC: 1152
Ensembl: ENSG00000112276
Vega: OTTHUMG00000015291
Pharos: Q8NE79(Tbio)
UniProt: Q8NE79
LinkDB
Position
6q21
AA seq 360 aa
MNYTESSPLRESTAIGFTPELESIIPVPSNKTTCENWREIHHLVFHVANICFAVGLVIPT
TLHLHMIFLRGMLTLGCTLYIVWATLYRCALDIMIWNSVFLGVNILHLSYLLYKKRPVKI
EKELSGMYRRLFEPLRVPPDLFRRLTGQFCMIQTLKKGQTYAAEDKTSVDDRLSILLKGK
MKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIIADDNCRFLCWSRERLTYFLE
SEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS
DSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaattatacagagtccagcccattgagagaatcaactgccataggttttacacctgag
ttagaaagtatcatacctgtgccttccaataagaccacttgtgaaaactggagagagata
catcatctggtttttcatgtagcaaatatttgttttgcagttgggttggttattccaact
actcttcaccttcatatgatatttcttaggggaatgttaactctaggatgtaccctttat
atcgtctgggccactctctaccgatgtgccttggatataatgatctggaactctgtgttc
ttgggtgtcaacattttgcatctgtcgtatcttttatacaagaagagaccggtaaagatt
gaaaaggaactcagtggcatgtaccggcgattgtttgaaccactccgtgtgcctccagat
ttgttcagaagactaactggacagttttgcatgatccaaaccttgaaaaagggccaaact
tatgctgcagaggataaaacctcagttgatgaccgtctgagtattctcttgaagggaaaa
atgaaggtctcctatcgaggacattttctgcataacatttacccctgtgcctttatagat
tctcctgaatttagatcaactcagatgcacaaaggtgaaaaattccaggtcaccattatt
gcagatgataactgcagatttttatgctggtcaagagaaagattaacatactttctggaa
tcagaacctttcttgtatgaaatctttaggtatcttattggaaaagacatcacaaataag
ctctactcattgaatgatcccaccttaaatgataaaaaagccaaaaagctggaacatcag
ctcagcctctgcacacagatctccatgttggaaatgaggaacagtatagccagctccagt
gacagtgacgacggcttgcaccagtttcttcggggtacctccagcatgtcctctcttcat
gtgtcatccccacaccagcgagcctctgccaagatgaaaccgatagaagaaggagcagaa
gatgatgatgacgtttttgaaccggcatctccaaatacattgaaagtccatcagctgcct
tga

DBGET integrated database retrieval system