KEGG   Homo sapiens (human): 11151Help
Entry
11151             CDS       T01001                                 

Gene name
CORO1A, CLABP, CLIPINA, HCORO1, IMD8, TACO, p57
Definition
(RefSeq) coronin 1A
  KO
K13882  coronin-1A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa05152  Tuberculosis
Disease
H00091  T-B+Severe combined immunodeficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    11151 (CORO1A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    11151 (CORO1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    11151 (CORO1A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    11151 (CORO1A)
   04147 Exosome [BR:hsa04147]
    11151 (CORO1A)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Coronins
    11151 (CORO1A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     11151 (CORO1A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   11151 (CORO1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trimer_CC DUF1899 WD40_4 WD40 ANAPC4_WD40 CENP-Q AKNA DUF1465 FlaC_arch Vps51 CLZ Wtap DivIC DUF2730 DUF5082
Motif
Other DBs
NCBI-GeneID: 11151
NCBI-ProteinID: NP_001180262
OMIM: 605000
HGNC: 2252
Ensembl: ENSG00000102879
Vega: OTTHUMG00000132148
Pharos: P31146(Tbio)
UniProt: P31146 A0A024R611
LinkDB All DBs
Position
16p11.2
AA seq 461 aa AA seqDB search
MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFL
VLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLMLPL
REPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTGAAMLTLGPEVHPDTIY
SVDWSRDGGLICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVRAVFVSEGKILTTGFS
RMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSE
APFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERRCEPIAMTVPRKSDLFQ
EDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPE
ASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcaggtggtccgctccagcaagttccgccacgtgtttggacagccggccaag
gccgaccagtgctatgaagatgtgcgcgtctcacagaccacctgggacagtggcttctgt
gctgtcaaccctaagtttgtggccctgatctgtgaggccagcgggggaggggccttcctg
gtgctgcccctgggcaagactggacgtgtggacaagaatgcgcccacggtctgtggccac
acagcccctgtgctagacatcgcctggtgcccgcacaatgacaacgtcattgccagtggc
tccgaggactgcacagtcatggtgtgggagatcccagatgggggcctgatgctgcccctg
cgggagcccgtcgtcaccctggagggccacaccaagcgtgtgggcattgtggcctggcac
accacagcccagaacgtgctgctcagtgcaggttgtgacaacgtgatcatggtgtgggac
gtgggcactggggcggccatgctgacactgggcccagaggtgcacccagacacgatctac
agtgtggactggagccgagatggaggcctcatttgtacctcctgccgtgacaagcgcgtg
cgcatcatcgagccccgcaaaggcactgtcgtagctgagaaggaccgtccccacgagggg
acccggcccgtgcgtgcagtgttcgtgtcggaggggaagatcctgaccacgggcttcagc
cgcatgagtgagcggcaggtggcgctgtgggacacaaagcacctggaggagccgctgtcc
ctgcaggagctggacaccagcagcggtgtcctgctgcccttctttgaccctgacaccaac
atcgtctacctctgtggcaagggtgacagctcaatccggtactttgagatcacttccgag
gcccctttcctgcactatctctccatgttcagttccaaggagtcccagcggggcatgggc
tacatgcccaaacgtggcctggaggtgaacaagtgtgagatcgccaggttctacaagctg
cacgagcggaggtgtgagcccattgccatgacagtgcctcgaaagtcggacctgttccag
gaggacctgtacccacccaccgcagggcccgaccctgccctcacggctgaggagtggctg
gggggtcgggatgctgggcccctcctcatctccctcaaggatggctacgtacccccaaag
agccgggagctgagggtcaaccggggcctggacaccgggcgcaggagggcagcaccagag
gccagtggcactcccagctcggatgccgtgtctcggctggaggaggagatgcggaagctc
caggccacggtgcaggagctccagaagcgcttggacaggctggaggagacagtccaggcc
aagtag

DBGET integrated database retrieval system