KEGG   Homo sapiens (human): 11213Help
Entry
11213             CDS       T01001                                 

Gene name
IRAK3, ASRT5, IRAKM
Definition
(RefSeq) interleukin 1 receptor associated kinase 3
  KO
K04732  interleukin-1 receptor-associated kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    11213 (IRAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    11213 (IRAK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     11213 (IRAK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  IRAK family
   11213 (IRAK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Death FTA2
Motif
Other DBs
NCBI-GeneID: 11213
NCBI-ProteinID: NP_009130
OMIM: 604459
HGNC: 17020
Ensembl: ENSG00000090376
Vega: OTTHUMG00000169002
Pharos: Q9Y616(Tchem)
UniProt: Q9Y616
LinkDB All DBs
Structure
PDB: 

Position
12q14.3
AA seq 596 aa AA seqDB search
MAGNCGARGALSAHTLLFDLPPALLGELCAVLDSCDGALGWRGLAERLSSSWLDVRHIEK
YVDQGKSGTRELLWSWAQKNKTIGDLLQVLQEMGHRRAIHLITNYGAVLSPSEKSYQEGG
FPNILFKETANVTVDNVLIPEHNEKGILLKSSISFQNIIEGTRNFHKDFLIGEGEIFEVY
RVEIQNLTYAVKLFKQEKKMQCKKHWKRFLSELEVLLLFHHPNILELAAYFTETEKFCLI
YPYMRNGTLFDRLQCVGDTAPLPWHIRIGILIGISKAIHYLHNVQPCSVICGSISSANIL
LDDQFQPKLTDFAMAHFRSHLEHQSCTINMTSSSSKHLWYMPEEYIRQGKLSIKTDVYSF
GIVIMEVLTGCRVVLDDPKHIQLRDLLRELMEKRGLDSCLSFLDKKVPPCPRNFSAKLFC
LAGRCAATRAKLRPSMDEVLNTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVE
DDESQNNNLLPSDEGLRIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPSSSCE
ESWFPKYIVPSQDLRPYKVNIDPSSEAPGHSCRSRPVESSCSSKFSWDEYEQYKKE
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaactgtggggcccgcggcgcgctgtcggcgcacacgctgctgttcgacctg
ccgcccgcgctgctcggagagctctgcgctgttctggacagctgcgacggcgcgctgggc
tggcgcggcctggcagagagactttcaagcagctggctggatgttcgtcatattgaaaag
tatgtagaccaaggtaaaagtggaacaagagaattactttggtcctgggcacagaaaaac
aagaccatcggtgaccttttacaggtcctccaggagatgggacatcgtcgagctattcat
ttaattacaaactatggagcagtgttgagtccttcagagaagagttatcaggaaggtgga
tttccaaatatattattcaaggaaacagccaatgtcaccgtggataatgttcttattcct
gaacataatgaaaaaggaatactgcttaaatcttccatcagctttcaaaatatcatagaa
ggaactagaaatttccacaaagacttcctaattggagaaggagagatttttgaggtatac
agagtggagattcaaaacctaacatatgctgtcaaattatttaaacaggagaaaaaaatg
cagtgtaagaagcattggaagaggtttttatctgagcttgaagttttactactgtttcat
cacccaaacatactagagttggctgcatattttacagagactgagaagttctgtctgatt
tatccatacatgagaaatggaacactttttgacagattgcagtgtgtaggtgacacggcc
ccactcccttggcacattcgaatcggtatattaataggaatatccaaagccattcactac
ctgcacaacgttcaaccatgctcggtcatctgtggcagtatatcaagtgcaaacatcctt
ttggatgatcagtttcaacccaaactaactgattttgccatggcacacttccggtcccac
ctagaacatcagagttgtaccataaatatgaccagcagcagcagtaaacatctgtggtac
atgccagaagagtacatcagacaggggaaactttccattaaaacagatgtctacagcttt
ggaattgtaataatggaagttctaacaggatgtagagtagtgttagatgatccaaaacat
atccagctgcgggatctccttagagaattgatggagaagagaggcctggattcatgtctc
tcatttctagataagaaagtgcctccctgccctcggaatttctctgccaagctcttctgt
ttggcaggccggtgtgctgcaacgcgggcaaagttaagaccatcaatggatgaagtttta
aatactcttgaaagtactcaagccagcttgtattttgctgaagatcctcccacatcacta
aagtccttcaggtgtccttctcctctattcctggagaatgtaccaagtattccagtggaa
gatgatgaaagccagaataacaatttactaccttctgatgaaggcctgaggatagacaga
atgactcagaaaactccttttgaatgcagccagtctgaggttatgtttctgagcttggac
aaaaagccagagagcaagagaaatgaggaagcttgcaacatgcccagttcttcttgtgaa
gaaagttggttcccaaagtatatagttccatcccaggacttaaggccctataaggtaaat
atagatccttcttcagaagctccagggcattcttgcaggagcaggccagtggagagcagc
tgttcctccaaattttcctgggatgaatatgaacagtacaaaaaagaataa

KEGG   Homo sapiens (human): 3654Help
Entry
3654              CDS       T01001                                 

Gene name
IRAK1, IRAK, pelle
Definition
(RefSeq) interleukin 1 receptor associated kinase 1
  KO
K04730  interleukin-1 receptor-associated kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06110  MAPK signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06211  Other MAPK signaling
nt06263  Hepatocellular carcinoma
  Element
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00549  HBV HBeAg to TLR2/4-NFKB signaling pathway
N00556  HBV HBe to TLR2/4-NFKB signaling pathway
N00557  HBV HBe to TLR2/4-NFKB signaling pathway
N00561  HSV ICP0 to TLR2/4-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3654 (IRAK1)
   04064 NF-kappa B signaling pathway
    3654 (IRAK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3654 (IRAK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    3654 (IRAK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    3654 (IRAK1)
   05135 Yersinia infection
    3654 (IRAK1)
   05133 Pertussis
    3654 (IRAK1)
   05152 Tuberculosis
    3654 (IRAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3654 (IRAK1)
   05162 Measles
    3654 (IRAK1)
   05161 Hepatitis B
    3654 (IRAK1)
   05168 Herpes simplex virus 1 infection
    3654 (IRAK1)
   05169 Epstein-Barr virus infection
    3654 (IRAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3654 (IRAK1)
   05140 Leishmaniasis
    3654 (IRAK1)
   05142 Chagas disease (American trypanosomiasis)
    3654 (IRAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    3654 (IRAK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     3654 (IRAK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  IRAK family
   3654 (IRAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Death APH RAMP
Motif
Other DBs
NCBI-GeneID: 3654
NCBI-ProteinID: NP_001560
OMIM: 300283
HGNC: 6112
Ensembl: ENSG00000184216
Vega: OTTHUMG00000024228
Pharos: P51617(Tchem)
UniProt: P51617
LinkDB All DBs
Structure
PDB: 

Position
Xq28
AA seq 712 aa AA seqDB search
MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE
RSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSS
IPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTK
PGPESSVSLLQGARPFPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKR
LKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRL
HCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFG
LARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAG
QRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDP
RPGPCPPELGLGLGQLACCCLHRRAKRRPPMTQVYERLEKLQAVVAGVPGHSEAASCIPP
SPQENSYVSSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALR
SWHLTPSCPLDPAPLREAGCPQGDTAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQI
IINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atggccggggggccgggcccgggggagcccgcagcccccggcgcccagcacttcttgtac
gaggtgccgccctgggtcatgtgccgcttctacaaagtgatggacgccctggagcccgcc
gactggtgccagttcgccgccctgatcgtgcgcgaccagaccgagctgcggctgtgcgag
cgctccgggcagcgcacggccagcgtcctgtggccctggatcaaccgcaacgcccgtgtg
gccgacctcgtgcacatcctcacgcacctgcagctgctccgtgcgcgggacatcatcaca
gcctggcaccctcccgccccgcttccgtccccaggcaccactgccccgaggcccagcagc
atccctgcacccgccgaggccgaggcctggagcccccggaagttgccatcctcagcctcc
accttcctctccccagcttttccaggctcccagacccattcagggcctgagctcggcctg
gtcccaagccctgcttccctgtggcctccaccgccatctccagccccttcttctaccaag
ccaggcccagagagctcagtgtccctcctgcagggagcccgcccctttccgttttgctgg
cccctctgtgagatttcccggggcacccacaacttctcggaggagctcaagatcggggag
ggtggctttgggtgcgtgtaccgggcggtgatgaggaacacggtgtatgctgtgaagagg
ctgaaggagaacgctgacctggagtggactgcagtgaagcagagcttcctgaccgaggtg
gagcagctgtccaggtttcgtcacccaaacattgtggactttgctggctactgtgctcag
aacggcttctactgcctggtgtacggcttcctgcccaacggctccctggaggaccgtctc
cactgccagacccaggcctgcccacctctctcctggcctcagcgactggacatccttctg
ggtacagcccgggcaattcagtttctacatcaggacagccccagcctcatccatggagac
atcaagagttccaacgtccttctggatgagaggctgacacccaagctgggagactttggc
ctggcccggttcagccgctttgccgggtccagccccagccagagcagcatggtggcccgg
acacagacagtgcggggcaccctggcctacctgcccgaggagtacatcaagacgggaagg
ctggctgtggacacggacaccttcagctttggggtggtagtgctagagaccttggctggt
cagagggctgtgaagacgcacggtgccaggaccaagtatctgaaagacctggtggaagag
gaggctgaggaggctggagtggctttgagaagcacccagagcacactgcaagcaggtctg
gctgcagatgcctgggctgctcccatcgccatgcagatctacaagaagcacctggacccc
aggcccgggccctgcccacctgagctgggcctgggcctgggccagctggcctgctgctgc
ctgcaccgccgggccaaaaggaggcctcctatgacccaggtgtacgagaggctagagaag
ctgcaggcagtggtggcgggggtgcccgggcattcggaggccgccagctgcatcccccct
tccccgcaggagaactcctacgtgtccagcactggcagagcccacagtggggctgctcca
tggcagcccctggcagcgccatcaggagccagtgcccaggcagcagagcagctgcagaga
ggccccaaccagcccgtggagagtgacgagagcctaggcggcctctctgctgccctgcgc
tcctggcacttgactccaagctgccctctggacccagcacccctcagggaggccggctgt
cctcagggggacacggcaggagaatcgagctgggggagtggcccaggatcccggcccaca
gccgtggaaggactggcccttggcagctctgcatcatcgtcgtcagagccaccgcagatt
atcatcaaccctgcccgacagaagatggtccagaagctggccctgtacgaggatggggcc
ctggacagcctgcagctgctgtcgtccagctccctcccaggcttgggcctggaacaggac
aggcaggggcccgaagaaagtgatgaatttcagagctga

KEGG   Homo sapiens (human): 3656Help
Entry
3656              CDS       T01001                                 

Gene name
IRAK2, IRAK-2
Definition
(RefSeq) interleukin 1 receptor associated kinase 2
  KO
K04731  interleukin-1 receptor-associated kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04722  Neurotrophin signaling pathway
hsa05152  Tuberculosis
Disease
H01358  Atopic dermatitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    3656 (IRAK2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3656 (IRAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    3656 (IRAK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     3656 (IRAK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  IRAK family
   3656 (IRAK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Death
Motif
Other DBs
NCBI-GeneID: 3656
NCBI-ProteinID: NP_001561
OMIM: 603304
HGNC: 6113
Ensembl: ENSG00000134070
Vega: OTTHUMG00000155358
Pharos: O43187(Tbio)
UniProt: O43187
LinkDB All DBs
Structure
PDB: 

Position
3p25.3
AA seq 625 aa AA seqDB search
MACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITREL
LWWWGMRQATVQQLVDLLCRLELYRAAQIILNWKPAPEIRCPIPAFPDSVKPEKPLAASV
RKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFST
SIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKLR
ETACSSPGSIERFFQAELQICLRCCHPNVLPVLGFCAARQFHSFIYPYMANGSLQDRLQG
QGGSDPLPWPQRVSICSGLLCAVEYLHGLEIIHSNVKSSNVLLDQNLTPKLAHPMAHLCP
VNKRSKYTMMKTHLLRTSAAYLPEDFIRVGQLTKRVDIFSCGIVLAEVLTGIPAMDNNRS
PVYLKDLLLSDIPSSTASLCSRKTGVENVMAKEICQKYLEKGAGRLPEDCAEALATAACL
CLRRRNTSLQEVCGSVAAVEERLRGRETLLPWSGLSEGTGSSSNTPEETDDVDNSSLDAS
SSMSVAPWAGAATPLLPTENGEGRLRVIVGREADSSSEACVGLEPPQDVTETSWQIEINE
AKRKLMENILLYKEEKVDSIELFGP
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggcctgctacatctaccagctgccctcctgggtgctggacgacctgtgccgcaacatg
gacgcgctcagcgagtgggactggatggagttcgcctcctacgtgatcacagacctgacc
cagctgcggaagatcaagtccatggagcgggtgcagggtgtgagcatcacgcgggagctg
ctgtggtggtggggcatgcggcaggccaccgtccagcaacttgtggacctcctgtgccgc
ctggagctctaccgggctgcccagatcatcctgaactggaaaccggctcctgaaatcagg
tgtcccattccagccttccctgactctgtgaagccagaaaagcctttggcagcttctgta
agaaaggctgaggatgaacaggaagaggggcagcctgtgaggatggccacctttccaggc
ccagggtcctctccagccagagcccaccagccggcctttctccagcctcctgaagaagat
gcccctcattccttgagaagcgacctccccacttcgtctgattcaaaggacttcagcacc
tccattcctaagcaggaaaaacttttgagcttggctggagacagccttttctggagtgag
gcagacgtggtccaggcaaccgatgacttcaatcaaaaccgcaaaatcagccaggggacc
tttgctgacgtctacagagggcacaggcacgggaagccattcgtcttcaagaagctcaga
gagacagcctgttcaagtccaggatcaatcgaaagattcttccaggcagagttgcagatt
tgtcttagatgctgccaccccaatgtcttacctgtgctgggcttctgtgctgcaagacag
tttcacagcttcatctacccctacatggcaaatggttccctacaggacagactgcagggt
cagggtggctcggaccccctcccctggccccagcgtgtcagcatctgctcagggctgctc
tgtgccgtcgagtacctgcatggtctggagatcatccacagcaacgtcaagagctctaat
gtcttgctggaccaaaatctcacccccaaacttgctcacccaatggctcatctgtgtcct
gtcaacaaaaggtcaaaatacaccatgatgaagactcacctgctccggacgtcagccgcg
tatctgccagaggatttcatccgggtggggcagctgacaaagcgagtggacatcttcagc
tgtggaatagtgttggccgaggtcctcacgggcatccctgcaatggataacaaccgaagc
ccggtttacctgaaggacttactcctcagtgatattccaagcagcaccgcctcgctctgc
tccaggaagacgggcgtggagaacgtgatggcaaaggagatctgccagaagtacctggag
aagggcgcagggaggcttccggaggactgcgccgaggccctggccacggctgcctgcctg
tgcctgcggaggcgtaacaccagcctgcaggaggtgtgtggctctgtggctgctgtggaa
gagcggctccgaggtcgggagacgttgctcccttggagtgggctttctgagggtacaggc
tcttcttccaacaccccagaggaaacagacgacgttgacaattccagccttgatgcctcc
tcctccatgagtgtggcaccctgggcaggggctgccaccccacttctccccacagagaat
ggggaaggaaggctgcgggtcatcgtgggaagggaggctgactcctcctctgaggcctgt
gttggcctggagcctccccaggatgttacagaaacttcgtggcaaattgagatcaatgag
gccaaaaggaaactgatggagaatattctgctctacaaagaggaaaaagtggacagcatt
gagctctttggcccctga

KEGG   Homo sapiens (human): 51135Help
Entry
51135             CDS       T01001                                 

Gene name
IRAK4, IPD1, IRAK-4, NY-REN-64, REN64
Definition
(RefSeq) interleukin 1 receptor associated kinase 4
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06110  MAPK signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06211  Other MAPK signaling
nt06263  Hepatocellular carcinoma
  Element
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00549  HBV HBeAg to TLR2/4-NFKB signaling pathway
N00556  HBV HBe to TLR2/4-NFKB signaling pathway
N00557  HBV HBe to TLR2/4-NFKB signaling pathway
N00561  HSV ICP0 to TLR2/4-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
Disease
H00096  Defects of toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    51135 (IRAK4)
   04064 NF-kappa B signaling pathway
    51135 (IRAK4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    51135 (IRAK4)
   04621 NOD-like receptor signaling pathway
    51135 (IRAK4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    51135 (IRAK4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    51135 (IRAK4)
   05135 Yersinia infection
    51135 (IRAK4)
   05133 Pertussis
    51135 (IRAK4)
   05152 Tuberculosis
    51135 (IRAK4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    51135 (IRAK4)
   05162 Measles
    51135 (IRAK4)
   05164 Influenza A
    51135 (IRAK4)
   05161 Hepatitis B
    51135 (IRAK4)
   05168 Herpes simplex virus 1 infection
    51135 (IRAK4)
   05169 Epstein-Barr virus infection
    51135 (IRAK4)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    51135 (IRAK4)
   05140 Leishmaniasis
    51135 (IRAK4)
   05142 Chagas disease (American trypanosomiasis)
    51135 (IRAK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    51135 (IRAK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     51135 (IRAK4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  IRAK family
   51135 (IRAK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Pkinase_fungal Haspin_kinase Death Focal_AT
Motif
Other DBs
NCBI-GeneID: 51135
NCBI-ProteinID: NP_001107654
OMIM: 606883
HGNC: 17967
Ensembl: ENSG00000198001
Vega: OTTHUMG00000169425
Pharos: Q9NWZ3(Tchem)
UniProt: Q9NWZ3 Q69FE3 B4E359
LinkDB All DBs
Structure
PDB: 

Position
12q12
AA seq 460 aa AA seqDB search
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITV
QQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNF
DERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGIN
FLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND
ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacccataacaccatcaacatatgtgcgctgcctcaatgttggactaattagg
aagctgtcagattttattgatcctcaagaaggatggaagaagttagctgtagctattaaa
aaaccatctggtgatgatagatacaatcagtttcacataaggagatttgaagcattactt
caaactggaaaaagtcccacttctgaattactgtttgactggggcaccacaaattgcaca
gttggtgatcttgtggatcttttgatccaaaatgaattttttgctcctgcgagtcttttg
ctcccagatgctgttcccaaaactgctaatacactaccttctaaagaagctataacagtt
cagcaaaaacagatgcctttctgtgacaaagacaggacattgatgacacctgtgcagaat
cttgaacaaagctatatgccacctgactcctcaagtccagaaaataaaagtttagaagtt
agtgatacacgttttcacagtttttcattttatgaattgaagaatgtcacaaataacttt
gatgaacgacccatttctgttggtggtaataaaatgggagagggaggatttggagttgta
tataaaggctacgtaaataacacaactgtggcagtgaagaagcttgcagcaatggttgac
attactactgaagaactgaaacagcagtttgatcaagaaataaaagtaatggcaaagtgt
caacatgaaaacttagtagaactacttggtttctcaagtgatggagatgacctctgctta
gtatatgtttacatgcctaatggttcattgctagacagactctcttgcttggatggtact
ccaccactttcttggcacatgagatgcaagattgctcagggtgcagctaatggcatcaat
tttctacatgaaaatcatcatattcatagagatattaaaagtgcaaatatcttactggat
gaagcttttactgctaaaatatctgactttggccttgcacgggcttctgagaagtttgcc
cagacagtcatgactagcagaattgtgggaacaacagcttatatggcaccagaagctttg
cgtggagaaataacacccaaatctgatatttacagctttggtgtggttttactagaaata
ataactggacttccagctgtggatgaacaccgtgaacctcagttattgctagatattaaa
gaagaaattgaagatgaagaaaagacaattgaagattatattgataaaaagatgaatgat
gctgattccacttcagttgaagctatgtactctgttgctagtcaatgtctgcatgaaaag
aaaaataagagaccagacattaagaaggttcaacagctgctgcaagagatgacagcttct
taa

DBGET integrated database retrieval system