KEGG   Homo sapiens (human): 11214
Entry
11214             CDS       T01001                                 

Gene name
AKAP13, AKAP-13, AKAP-Lbc, ARHGEF13, BRX, HA-3, Ht31, LBC, PRKA13, PROTO-LB, PROTO-LBC, c-lbc, p47
Definition
(RefSeq) A-kinase anchoring protein 13
  KO
K16529  A-kinase anchor protein 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    11214 (AKAP13)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    11214 (AKAP13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    11214 (AKAP13)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    11214 (AKAP13)
SSDB
Motif
Pfam: PH_16 RhoGEF PH C1_1 RII_binding_1 Prok-RING_1 C1_2
Other DBs
NCBI-GeneID: 11214
NCBI-ProteinID: NP_009131
OMIM: 604686
HGNC: 371
Ensembl: ENSG00000170776
Vega: OTTHUMG00000172205
Pharos: Q12802(Tbio)
UniProt: Q12802
LinkDB
Structure
PDB: 
6BCA 4D0N 4D0O 2LG1

Position
15q25.3
AA seq 2813 aa
MKLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLVFLGSTLRHCTSTRKVSSDTLETIAP
GHDCCETVKVQLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQQALNFTRFLD
QSGPPSGDVNSLDKKLVLAFRHLKLPTEWNVLGTDQSLHDAGPRETLMHFAVRLGLLRLT
WFLLQKPGGRGALSIHNQEGATPVSLALERGYHKLHQLLTEENAGEPDSWSSLSYEIPYG
DCSVRHHRELDIYTLTSESDSHHEHPFPGDGCTGPIFKLMNIQQQLMKTNLKQMDSLMPL
MMTAQDPSSAPETDGQFLPCAPEPTDPQRLSSSEETESTQCCPGSPVAQTESPCDLSSIV
EEENTDRSCRKKNKGVERKGEEVEPAPIVDSGTVSDQDSCLQSLPDCGVKGTEGLSSCGN
RNEETGTKSSGMPTDQESLSSGDAVLQRDLVMEPGTAQYSSGGELGGISTTNVSTPDTAG
EMEHGLMNPDATVWKNVLQGGESTKERFENSNIGTAGASDVHVTSKPVDKISVPNCAPAA
SSLDGNKPAESSLAFSNEETSTEKTAETETSRSREESADAPVDQNSVVIPAAAKDKISDG
LEPYTLLAAGIGEAMSPSDLALLGLEEDVMPHQNSETNSSHAQSQKGKSSPICSTTGDDK
LCADSACQQNTVTSSGDLVAKLCDNIVSESESTTARQPSSQDPPDASHCEDPQAHTVTSD
PVRDTQERADFCPFKVVDNKGQRKDVKLDKPLTNMLEVVSHPHPVVPKMEKELVPDQAVI
SDSTFSLANSPGSESVTKDDALSFVPSQKEKGTATPELHTATDYRDGPDGNSNEPDTRPL
EDRAVGLSTSSTAAELQHGMGNTSLTGLGGEHEGPAPPAIPEALNIKGNTDSSLQSVGKA
TLALDSVLTEEGKLLVVSESSAAQEQDKDKAVTCSSIKENALSSGTLQEEQRTPPPGQDT
QQFHEKSISADCAKDKALQLSNSPGASSAFLKAETEHNKEVAPQVSLLTQGGAAQSLVPP
GASLATESRQEALGAEHNSSALLPCLLPDGSDGSDALNCSQPSPLDVGVKNTQSQGKTSA
CEVSGDVTVDVTGVNALQGMAEPRRENISHNTQDILIPNVLLSQEKNAVLGLPVALQDKA
VTDPQGVGTPEMIPLDWEKGKLEGADHSCTMGDAEEAQIDDEAHPVLLQPVAKELPTDME
LSAHDDGAPAGVREVMRAPPSGRERSTPSLPCMVSAQDAPLPKGADLIEEAASRIVDAVI
EQVKAAGALLTEGEACHMSLSSPELGPLTKGLESAFTEKVSTFPPGESLPMGSTPEEATG
SLAGCFAGREEPEKIILPVQGPEPAAEMPDVKAEDEVDFRASSISEEVAVGSIAATLKMK
QGPMTQAINRENWCTIEPCPDAASLLASKQSPECENFLDVGLGRECTSKQGVLKRESGSD
SDLFHSPSDDMDSIIFPKPEEEHLACDITGSSSSTDDTASLDRHSSHGSDVSLSQILKPN
RSRDRQSLDGFYSHGMGAEGRESESEPADPGDVEEEEMDSITEVPANCSVLRSSMRSLSP
FRRHSWGPGKNAASDAEMNHRSSMRVLGDVVRRPPIHRRSFSLEGLTGGAGVGNKPSSSL
EVSSANAEELRHPFSGEERVDSLVSLSEEDLESDQREHRMFDQQICHRSKQQGFNYCTSA
ISSPLTKSISLMTISHPGLDNSRPFHSTFHNTSANLTESITEENYNFLPHSPSKKDSEWK
SGTKVSRTFSYIKNKMSSSKKSKEKEKEKDKIKEKEKDSKDKEKDKKTVNGHTFSSIPVV
GPISCSQCMKPFTNKDAYTCANCSAFVHKGCRESLASCAKVKMKQPKGSLQAHDTSSLPT
VIMRNKPSQPKERPRSAVLLVDETATTPIFANRRSQQSVSLSKSVSIQNITGVGNDENMS
NTWKFLSHSTDSLNKISKVNESTESLTDEGVGTDMNEGQLLGDFEIESKQLEAESWSRII
DSKFLKQQKKDVVKRQEVIYELMQTEFHHVRTLKIMSGVYSQGMMADLLFEQQMVEKLFP
CLDELISIHSQFFQRILERKKESLVDKSEKNFLIKRIGDVLVNQFSGENAERLKKTYGKF
CGQHNQSVNYFKDLYAKDKRFQAFVKKKMSSSVVRRLGIPECILLVTQRITKYPVLFQRI
LQCTKDNEVEQEDLAQSLSLVKDVIGAVDSKVASYEKKVRLNEIYTKTDSKSIMRMKSGQ
MFAKEDLKRKKLVRDGSVFLKNAAGRLKEVQAVLLTDILVFLQEKDQKYIFASLDQKSTV
ISLKKLIVREVAHEEKGLFLISMGMTDPEMVEVHASSKEERNSWIQIIQDTINTLNRDED
EGIPSENEEEKKMLDTRARELKEQLHQKDQKILLLLEEKEMIFRDMAECSTPLPEDCSPT
HSPRVLFRSNTEEALKGGPLMKSAINEVEILQGLVSGNLGGTLGPTVSSPIEQDVVGPVS
LPRRAETFGGFDSHQMNASKGGEKEEGDDGQDLRRTESDSGLKKGGNANLVFMLKRNSEQ
VVQSVVHLYELLSALQGVVLQQDSYIEDQKLVLSERALTRSLSRPSSLIEQEKQRSLEKQ
RQDLANLQKQQAQYLEEKRRREREWEARERELREREALLAQREEEVQQGQQDLEKEREEL
QQKKGTYQYDLERLRAAQKQLEREQEQLRREAERLSQRQTERDLCQVSHPHTKLMRIPSF
FPSPEEPPSPSAPSIAKSGSLDSELSVSPKRNSISRTHKDKGPFHILSSTSQTNKGPEGQ
SQAPASTSASTRLFGLTKPKEKKEKKKKNKTSRSQPGDGPASEVSAEGEEIFC
NT seq 8442 nt   +upstreamnt  +downstreamnt
atgaaacttaatccacagcaagctcccttatatggtgattgtgttgttacagtgctgctt
gctgaagaggacaaagctgaagatgatgtagtgttttacttggtatttttgggttccacc
ctccgtcactgtacaagtactcggaaggtcagttctgatacattggagaccattgctcct
ggtcatgattgttgtgaaacagtgaaggtgcagctctgtgcttccaaagagggccttccc
gtgtttgtggtggctgaagaagactttcatttcgtccaggatgaagcgtatgatgcagct
caattcctagcaaccagtgctggaaatcagcaggctttgaactttacccgttttcttgac
cagtcaggacccccatctggggatgtgaattcccttgataagaagttggtgctggcattc
aggcacctgaagctgcccacggagtggaatgtattggggacagatcagagtttgcatgat
gctggcccgcgagagacattgatgcattttgctgtgcggctgggactgctgaggttgacg
tggttcctgttgcagaagccaggtggccgcggagctctcagtatccacaaccaggaaggg
gcgacgcctgtgagcttggccttggagcgaggctatcacaagctgcaccagcttctaacc
gaggagaatgctggagaaccagactcctggagcagtttatcctatgaaataccgtatgga
gactgttctgtgaggcatcatcgagagttggacatctatacattaacctctgagtctgat
tcacatcatgaacacccatttcctggagacggttgcactggaccaatttttaaacttatg
aacatccaacagcaactaatgaaaacaaacctcaagcagatggacagtcttatgccctta
atgatgacagcacaggatccttccagtgccccagagacagatggccagtttcttccctgt
gcaccggagcccacggaccctcagcgactttcttcttctgaagagactgagagcactcag
tgctgcccagggagccctgttgcacagactgaaagtccctgtgatttgtcaagcatagtt
gaggaggagaatacagaccgttcctgtaggaagaaaaataaaggcgtggaaagaaaaggg
gaagaggtggagccagcacctattgtggactctggaactgtatctgatcaagacagctgc
cttcagagcttgcctgattgtggagtaaagggcacggaaggcctttcgtcctgtggaaac
agaaatgaagaaactggaacaaaatcttctggaatgcccacagaccaggagtccctgagc
agtggagatgctgtgcttcagagagacttggtcatggagccaggcacagcccagtattcc
tctggaggtgaactgggaggcatttcaacaacaaatgtcagtaccccagacactgcaggg
gaaatggaacatgggctcatgaacccagatgccactgtttggaagaatgtgcttcaggga
ggggaaagtacaaaggaaagatttgagaactctaatattggcacagctggagcctctgac
gtgcacgtcacaagtaagcctgtggataaaatcagtgttccaaactgtgcccctgctgcc
agttccctggatggtaacaaacctgctgagtcttcacttgcatttagtaatgaagaaacc
tccactgaaaaaacagcagaaacggaaacttcacgaagtcgtgaggagagtgctgatgct
ccagtagatcagaattctgtggtgattccagctgctgcaaaagacaagatttcagatgga
ttagaaccttatactctcttagcagcaggcataggtgaggcaatgtcaccctcagattta
gcccttcttgggctggaagaagatgtaatgccacaccagaactcagaaacaaattcatct
catgctcaaagccaaaagggcaaatcctcacccatttgttctacaactggagacgataaa
ctttgtgcagactctgcatgtcaacagaacacagtgacttctagtggcgatttggttgca
aaactgtgtgataacatagttagcgagtccgaaagcaccacagcaaggcaacccagctca
caagatccacccgatgcctcccactgtgaagacccacaggctcatacagtcacctctgac
cctgtaagggatacccaggaacgtgcggatttttgtcctttcaaagtggtggataacaaa
ggccaacgaaaagatgtgaaactagataaacctttaacaaatatgcttgaggtggtttca
catccacatccagttgtccctaaaatggagaaagaactggtgccagaccaggcagtaata
tcagacagtactttctctctggcaaacagtccaggcagtgaatcagtaaccaaggatgac
gcactttcttttgtcccctcccagaaagaaaagggaacagcaactcctgaactacataca
gctacagattatagagatggcccagatggaaattcgaatgagcctgatacgcggccacta
gaagacagggcagtaggcctgtccacatcctccactgctgcagagcttcagcacgggatg
gggaataccagtctcacaggacttggtggagagcatgagggtcccgcccctccagcaatc
ccagaagctctgaatatcaaggggaacactgactcttccctgcaaagtgtgggtaaggcc
actttggctttagattcagttttgactgaagaaggaaaacttctggtggtttcagaaagc
tctgcagctcaggaacaagataaggataaagcggtgacctgttcctctattaaggaaaat
gctctctcttcaggaactttgcaggaagagcagagaacaccacctcctggacaagatact
caacaatttcatgaaaaatcaatctcagctgactgtgccaaggacaaagcacttcagcta
agtaattcaccgggtgcatcctctgcctttcttaaggcagaaactgaacataacaaggaa
gtggccccacaagtctcactgctgactcaaggtggggctgcccagagcctggtgccacca
ggagcaagtctggccacagagtcaaggcaggaagccttgggggcagagcacaacagctcc
gctctgttgccatgtctgttgccagatgggtctgatgggtccgatgctcttaactgcagt
cagccttctcctctggatgttggagtgaagaacactcaatcccagggaaaaactagtgcc
tgtgaggtgagtggagatgtgacggtggatgttacaggggttaatgctctacaaggtatg
gctgagcccagaagagagaatatatcacacaacacccaagacatcctgattccaaacgtc
ttgttgagccaagagaagaatgccgttctaggtttgccagtggctctacaggacaaagct
gtgactgacccacagggagttggaaccccagagatgatacctcttgattgggagaaaggg
aagctggagggagcagaccacagctgtaccatgggtgacgctgaggaagcccaaatagac
gatgaagcacatcctgtcctactgcagcctgttgccaaggagctccccacagacatggag
ctctcagcccatgatgatggggccccagctggtgtgagggaagtcatgcgagccccgcct
tcaggcagggaaaggagcactccctctctaccttgcatggtctctgcccaggacgcacct
ctgcctaagggggcagacttgatagaggaggctgccagccgtatagtggatgctgtcatc
gaacaagtcaaggccgctggagcactgcttactgagggggaggcctgtcacatgtcactg
tccagccctgagttgggtcctctcactaaaggactagagagtgcttttacagaaaaagtg
agtactttcccacctggggagagcctaccaatgggcagtactcctgaggaagccacgggg
agccttgcaggatgttttgctggaagggaggagccagagaagatcattttacctgtccag
gggcctgagccagcagcagaaatgccagacgtgaaagctgaagatgaagtggattttaga
gcaagttcaatttctgaagaagtggctgtagggagcatagctgctacactgaagatgaag
caaggcccaatgacccaggcgataaaccgagaaaactggtgtacaatagagccatgccct
gatgcagcatctcttctggcttccaagcagagcccagaatgtgagaacttcctggatgtt
ggactgggcagagagtgtacctcaaaacaaggtgtacttaaaagagaatctgggagtgat
tctgacctctttcactcacccagtgatgacatggacagcatcatcttcccaaagccagag
gaagagcatttggcctgtgatatcaccggatccagttcatccaccgatgacacggcttca
ctggaccgacattcttctcatggcagtgatgtgtctctctcccagattttaaagccaaac
aggtcaagagatcggcaaagccttgatggattctacagccatgggatgggagctgagggt
cgagaaagtgagagtgagcctgctgacccaggcgacgtggaggaggaggagatggacagt
atcactgaagtgcctgcaaactgctctgtcctaaggagctccatgcgctctctttctccc
ttccggaggcacagctgggggcctgggaaaaatgcagccagcgatgcagaaatgaaccac
cggagttcaatgcgagttcttggggatgttgtcaggagacctcccattcataggagaagt
ttcagtctagaaggcttgacaggaggagctggtgtcggaaacaagccatcctcatctcta
gaagtaagctctgcaaatgccgaagagctcagacacccattcagtggtgaggaacgggtt
gactctttggtgtcactttcagaagaggatctggagtcagaccagagagaacataggatg
tttgatcagcagatatgtcacagatctaagcagcagggatttaattactgtacatcagcc
atttcctctccattgacaaaatccatctcattaatgacaatcagccatcctggattggac
aattcacggcccttccacagtaccttccacaataccagtgctaatctgactgagagtata
acagaagagaactataatttcctgccacatagcccctccaagaaagattctgaatggaag
agtggaacaaaagtcagtcgtacattcagctacatcaagaataaaatgtctagcagcaag
aagagcaaagaaaaggaaaaagaaaaagataagattaaggagaaggagaaagattctaaa
gacaaggagaaagataagaagactgtcaacgggcacactttcagttccattcctgttgtg
ggtcccatcagctgtagccagtgtatgaagcccttcaccaacaaagatgcctatacttgt
gcaaattgcagtgcttttgtccacaaaggctgccgagaaagtctagcctcctgtgcaaag
gtcaaaatgaagcagcccaaagggagccttcaggcacatgacacatcatcactgcccacg
gtcattatgagaaacaagccctcacagcccaaggagcgtcctcggtccgcagtcctcctg
gtggatgaaaccgctaccaccccaatatttgccaatagacgatcccagcagagtgtctcg
ctctccaaaagtgtctccatacagaacattactggagttggcaatgatgagaacatgtca
aacacctggaaattcctgtctcattcaacagactcactaaataaaatcagcaaggtcaat
gagtcaacagaatcacttactgatgagggagtaggtacagacatgaatgaaggacaacta
ctgggagactttgagattgagtccaaacagctggaagcagagtcttggagtcggataata
gacagcaagtttctaaaacagcaaaagaaagatgtggtcaaacggcaagaagtaatatat
gagttgatgcagacagagtttcatcatgtccgcactctcaagatcatgagtggtgtgtac
agccaggggatgatggcggatctgctttttgagcagcagatggtagaaaagctgttcccc
tgtttggatgagctgatcagtatccatagccaattcttccagaggattctggagcggaag
aaggagtctctggtggataaaagtgaaaagaactttctcatcaagaggataggggatgtg
cttgtaaatcagttttcaggtgagaatgcagaacgtttaaagaagacatatggcaagttt
tgtgggcaacataaccagtctgtaaactacttcaaagacctttatgccaaggataagcgt
tttcaagcctttgtaaagaagaagatgagcagttcagttgttagaaggcttggaattcca
gagtgcatattgcttgtaactcagcggattaccaagtacccagttttattccaaagaata
ttgcagtgtaccaaagacaatgaagtggagcaggaagatctagcacagtccttgagcctg
gtgaaggatgtgattggagctgtagacagcaaagtggcaagttatgaaaagaaagtgcgt
ctcaatgagatttatacaaagacagatagcaagtcaatcatgaggatgaagagtggtcag
atgtttgccaaggaagatttgaaacggaagaagcttgtacgtgatgggagtgtgtttctg
aagaatgcagcaggaaggttgaaagaggttcaagcagttcttctcactgacattttagtt
ttccttcaagaaaaagaccagaagtacatctttgcatcattggaccagaagtcaacagtg
atctctttaaagaagctgattgtgagagaagtggcacatgaggagaaaggtttattcctg
atcagcatggggatgacagatccagagatggtagaagtccatgccagctccaaagaggaa
cgaaacagctggattcagatcattcaggacacaatcaacaccctgaacagagatgaagat
gaaggaattcctagtgagaatgaggaagaaaagaaaatgttggacaccagagcccgagaa
ttaaaagaacaacttcaccagaaggaccaaaaaatcctactcttgttggaagagaaggag
atgattttccgggacatggctgagtgcagcacccctctcccagaggattgctccccaaca
catagccctagagttctcttccgctccaacacagaagaggctctcaaaggaggaccttta
atgaaaagtgcaataaatgaggtggagatccttcagggtttggtgagtggaaatctggga
ggcacacttgggccgactgtcagcagccccattgagcaagatgtggtcggtcccgtttcc
ctgccccggagagcagagacctttggaggatttgacagccatcagatgaatgcttcaaaa
ggaggcgagaaggaagagggagatgatggccaagatcttaggagaacggaatcagatagt
ggcctaaaaaagggtggaaatgctaacctggtatttatgcttaaaagaaacagtgagcag
gttgtccagagcgttgttcatctctacgagctcctcagcgctctgcagggtgtggtgctg
cagcaggacagctacattgaggaccagaaactggtgctgagcgagagggcgctcactcgc
agcttgtcccgcccgagctccctcattgagcaggagaagcagcgcagcctggagaagcag
cgccaggacctggccaacctgcagaagcagcaggcccagtacctcgaggagaagcgcagg
cgcgagcgtgagtgggaagctcgtgagagggagctgcgggagcgggaggccctcctggcc
cagcgcgaggaggaggtgcagcaggggcagcaggacctggaaaaggagcgggaggagctc
cagcagaagaagggcacataccagtatgacctggagcgactgcgtgctgcccagaaacag
cttgagagggaacaggagcagctgcgccgggaggcagagcggctcagccagcggcagaca
gaacgggacctgtgtcaggtttcccatccacataccaagctgatgaggatcccatcgttc
ttccccagtcctgaggagcccccctcgccatctgcaccttccatagccaaatcagggtca
ttggactcagaactttcagtgtccccaaaaaggaacagcatctctcggacacacaaagat
aaggggccttttcacatactgagttcaaccagccagacaaacaaaggaccagaagggcag
agccaggcccctgcgtccacctctgcctctacccgcctgtttgggttaacaaagccaaag
gaaaagaaggagaaaaaaaagaagaacaaaaccagccgctctcagcccggtgatggtccc
gcgtcagaagtatcagcagagggtgaagagatcttctgctga

KEGG   Homo sapiens (human): 23365
Entry
23365             CDS       T01001                                 

Gene name
ARHGEF12, LARG, PRO2792
Definition
(RefSeq) Rho guanine nucleotide exchange factor 12
  KO
K07532  Rho guanine nucleotide exchange factor 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04270  Vascular smooth muscle contraction
hsa04360  Axon guidance
hsa04611  Platelet activation
hsa04625  C-type lectin receptor signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05135  Yersinia infection
hsa05152  Tuberculosis
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
Network
nt06124  Chemokine signaling (viruses)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00405  CXCR4-GNA12/13-Rho signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
N01088  Escherichia EspH to LPA-GNA12/13-RhoA signaling pathway
N01097  LPA-GNA12/13-RhoA signaling pathway
N01104  LPA-GNAQ/11-RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    23365 (ARHGEF12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    23365 (ARHGEF12)
   04625 C-type lectin receptor signaling pathway
    23365 (ARHGEF12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    23365 (ARHGEF12)
  09158 Development and regeneration
   04360 Axon guidance
    23365 (ARHGEF12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    23365 (ARHGEF12)
   05205 Proteoglycans in cancer
    23365 (ARHGEF12)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    23365 (ARHGEF12)
   05135 Yersinia infection
    23365 (ARHGEF12)
   05152 Tuberculosis
    23365 (ARHGEF12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    23365 (ARHGEF12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23365 (ARHGEF12)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    23365 (ARHGEF12)
SSDB
Motif
Pfam: RGS-like PH_16 RhoGEF PDZ PDZ_6 PDZ_2 PH_13 Ribonuc_2-5A Tricorn_PDZ
Other DBs
NCBI-GeneID: 23365
NCBI-ProteinID: NP_056128
OMIM: 604763
HGNC: 14193
Ensembl: ENSG00000196914
Vega: OTTHUMG00000166143
Pharos: Q9NZN5(Tbio)
UniProt: Q9NZN5 B4E2K6
LinkDB
Structure
PDB: 
1TXD 1X86 2OS6 2OMJ

Position
11q23.3
AA seq 1544 aa
MSGTQSTITDRFPLKKPIRHGSILNRESPTDKKQKVERIASHDFDPTDSSSKKTKSSSEE
SRSEIYGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGT
LVTHSNHLEVVKLIKSGSYVALTVQGRPPGSPQIPLADSEVEPSVIGHMSPIMTSPHSPG
ASGNMERITSPVLMGEENNVVHNQKVEILRKMLQKEQERLQLLQEDYNRTPAQRLLKEIQ
EAKKHIPQLQEQLSKATGSAQDGAVVTPSRPLGDTLTVSEAETDPGDVLGRTDCSSGDAS
RPSSDNADSPKSGPKERIYLEENPEKSETIQDTDTQSLVGSPSTRIAPHIIGAEDDDFGT
EHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKHTNSKETRR
IFLEFHQFFLDRSAHLKVSVPDEMSADLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHL
EDFRQKRSMGLTLAESELTKLDAERDKDRLTLEKERTCAEQIVAKIEEVLMTAQAVEEDK
SSTMQYVILMYMKHLGVKVKEPRNLEHKRGRIGFLPKIKQSMKKDKEGEEKGKRRGFPSI
LGPPRRPSRHDNSAIGRAMELQKARHPKHLSTPSSVSPEPQDSAKLRQSGLANEGTDAGY
LPANSMSSVASGASFSQEGGKENDTGSKQVGETSAPGDTLDGTPRTLNTVFDFPPPPLDQ
VQEEECEVERVTEHGTPKPFRKFDSVAFGESQSEDEQFENDLETDPPNWQQLVSREVLLG
LKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQ
LHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKS
RQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKV
KKAADHCRQILNYVNQAVKEAENKQRLEDYQRRLDTSSLKLSEYPNVEELRNLDLTKRKM
IHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVI
KLSTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSTK
PIPLPQSTPGEGDNDEEDPSKLKEEQHGISVTGLQSPDRDLGLESTLISSKPQSHSLSTS
GKSEVRDLFVAERQFAKEQHTDGTLKEVGEDYQIAIPDSHLPVSEERWALDALRNLGLLK
QLLVQQLGLTEKSVQEDWQHFPRYRTASQGPQTDSVIQNSENIKAYHSGEGHMPFRTGTG
DIATCYSPRTSTESFAPRDSVGLAPQDSQASNILVMDHMIMTPEMPTMEPEGGLDDSGEH
FFDAREAHSDENPSEGDGAVNKEEKDVNLRISGNYLILDGYDPVQESSTDEEVASSLTLQ
PMTGIPAVESTHQQQHSPQNTHSDGAISPFTPEFLVQQRWGAMEYSCFEIQSPSSCADSQ
SQIMEYIHKIEADLEHLKKVEESYTILCQRLAGSALTDKHSDKS
NT seq 4635 nt   +upstreamnt  +downstreamnt
atgagtggcacacagtctactatcaccgacaggtttcccctcaaaaaacctataaggcat
ggaagtattttgaaccgagagtcaccaacagataagaagcagaaagttgagcgcattgca
tcacatgattttgaccccacagatagctcctccaagaagacaaagtctagttcagaggag
agtagatccgagatatatggtcttgttcagcgttgcgtaatcatccagaaagatgacaat
ggatttgggctgacggtcagtggagacaatccagtcttcgtacagtctgtcaaagaagat
ggagcagccatgcgggctggagtacagacaggtgatcgaatcatcaaggtgaatggaact
ctggtgactcattcaaatcatctggaggtggtgaagctaatcaaatctggttcctatgta
gctctcactgttcagggacgcccacctgggtcgccccagattccacttgccgactctgaa
gtagagccgtcagtcattggacatatgtctcccatcatgacatctcctcattcacctgga
gcatctgggaatatggagagaatcactagtcctgtgctcatgggggaggaaaacaatgtg
gttcataaccagaaagtagaaattctgagaaaaatgttacagaaagaacaggaacggcta
cagttattgcaggaagattacaaccgaacacctgcccaaagattgctaaaagagatccaa
gaggccaagaaacacattcctcagctgcaagagcagttatccaaagccacaggctctgct
caggatggagctgtagttacaccctccagacctttaggggacaccctaacagtcagtgag
gcagaaacagatcctggagatgtactgggcaggactgactgtagcagtggagatgcttct
cggcccagtagtgacaatgcagatagtcccaagagtggcccaaaagagagaatttatcta
gaggaaaacccagagaaaagtgaaacaattcaggacactgacactcaatcacttgtcgga
agtccctcaacccgtatagcacctcatattattggagcagaagatgatgattttggtact
gaacatgaacagatcaatggacagtgcagctgtttccagagcattgaattactaaaatct
cgcccggctcatttggctgttttcttacaccatgtagtttcacaatttgaccctgcgact
ttgctctgttatctctattcagacctgtataaacataccaattccaaagaaactcgtcgc
atcttccttgagtttcatcagttctttctagatcgatcagcacacctgaaagtttctgtt
cctgatgaaatgtctgcagatctagaaaagagaagacctgagctcattcctgaggatctg
catcgccactatatccaaactatgcaagaaagagtccatccagaagttcaaaggcactta
gaagattttcggcagaaacgtagtatgggactgaccttggctgaaagcgagctgactaaa
cttgatgcagagcgagacaaggaccgattgactttggagaaggagcggacatgtgcagaa
cagattgttgccaaaattgaagaagtattgatgactgctcaggctgtagaggaagataag
agctccaccatgcagtatgttattctcatgtatatgaagcatttgggagtaaaagtgaaa
gagcctcgaaatttggagcacaaacggggtcggattggatttcttcccaaaatcaagcaa
agtatgaagaaagataaagaaggggaagaaaaagggaagcgaagaggattccccagcatc
ctgggacccccacggagaccaagccgtcatgacaacagtgcaattggcagagccatggaa
ctacagaaggcgcgccaccctaagcacttatccacaccctcatctgtgagtcctgaacct
caggactctgccaagttgcgccagagtgggttagcaaatgaaggaacagacgctggatac
ctgcctgccaattccatgtcttctgtagcttcaggggcctctttttcccaggaaggaggg
aaagagaatgatacaggatcaaagcaagttggagaaacatcagcacctggagacacctta
gatggcacacctcgtactctcaatactgtctttgatttcccaccacctccattagaccaa
gtgcaggaggaggaatgtgaagtagaaagggtgactgaacatgggacaccaaagcccttt
cgaaagtttgacagtgtagcttttggagaaagtcaaagtgaggatgaacaatttgaaaat
gacttagagacagatccacccaactggcagcagcttgttagtcgagaagtgttactggga
ctaaaaccttgtgaaatcaaaagacaggaagtgattaatgaattgttctacactgaaaga
gctcatgttcgaacactgaaggttcttgatcaagtgttctatcagcgagtatccagagaa
ggaattctgtcaccctcagagctacggaaaattttttcaaacttggaagatattcttcaa
cttcatattggattgaatgaacaaatgaaggctgttcgaaagagaaatgagacctctgtt
atcgatcagattggggaagatttgctgacatggttcagcggaccaggagaggagaaattg
aaacatgctgctgctaccttttgcagtaaccaacctttcgccctggaaatgatcaaatct
cgtcagaaaaaggattctcgatttcagacttttgtgcaagatgctgaaagtaatccactg
tgtcgtcgtcttcaactgaaggatattattcccactcaaatgcaaaggcttactaagtac
ccacttctgttggataatattgccaaatacacagaatggccaacagaaagggagaaggtg
aagaaagctgcagatcactgtcgtcagatcttaaattatgtaaatcaggctgtcaaggag
gcagaaaacaagcagcgcctagaagattatcagcgtcgccttgatacctccagcctgaag
ttgtcagagtacccaaatgttgaagagctcaggaatttggatttaacaaaaaggaagatg
attcatgaagggccattggtttggaaggtgaatagagataaaactattgatttatacacg
ttgctgctggaagacattcttgtattgttacaaaagcaggatgatagactggttttaagg
tgtcatagtaagattctggcatctacagctgatagcaaacacacgtttagccctgtcatt
aagttgagtacagtgttggttcgacaagtggcaacagataacaaagctttattcgtcatt
tccatgtcagacaatggcgctcagatttatgaactggtggcacagacagtttctgaaaag
actgtctggcaggacctaatctgtcggatggctgcatcagtgaaggagcaatccacaaag
ccaattccattaccacagtcaacacctggcgaaggagataatgatgaagaagatccttca
aaattaaaagaggagcagcatggcatttcagtcactggtttgcagagtccagacagagat
ttgggattagaatctaccttaatatcgtcaaaacctcagtctcattcactgagtacctct
gggaaatcagaggtacgtgatctgtttgtggctgagagacagtttgcaaaggaacaacat
acagatgggacactaaaggaagttggagaagattatcaaatcgcaatcccagattcacac
ctgcctgtctcagaagaacggtgggcattggatgcactaagaaatttgggtttgttgaag
cagttgctggtgcaacagctaggtttgactgagaagagcgttcaggaagactggcaacat
ttcccaagatacagaacagcctctcaggggccgcagacagacagtgtcatccagaactct
gaaaatattaaggcctatcattctggtgaaggacatatgccctttagaactggaactggt
gacattgcaacttgttacagtccacggacttcaactgaatcttttgctccacgggattca
gtgggactggcaccccaggatagccaggcaagtaacattttagtaatggaccacatgatt
atgaccccagagatgcctaccatggagccagaagggggtcttgatgacagtggagagcac
ttttttgatgcccgtgaagcacatagtgatgagaatccatcagaaggtgatggagcagtt
aacaaggaagagaaggatgttaatttacgcatctcaggaaactatttgatccttgatggc
tatgacccagtgcaggagagttccacagatgaggaggttgcttcctcacttaccctgcag
cccatgacaggcatccctgctgtggaatccacccaccagcagcaacattctcctcagaat
actcactccgatggggcaatttcaccattcacccccgaatttctggtccagcagcgctgg
ggagctatggagtattcctgttttgagatccagagtccctcctcttgtgcagattcacag
agccagatcatggagtacattcataagatagaggctgaccttgaacacttaaagaaggtg
gaggaaagttacaccattctttgccaaaggctggctggatcagccctcacagacaagcac
tcagataaaagttag

KEGG   Homo sapiens (human): 9138
Entry
9138              CDS       T01001                                 

Gene name
ARHGEF1, GEF1, IMD62, LBCL2, LSC, P115-RHOGEF, SUB1.5
Definition
(RefSeq) Rho guanine nucleotide exchange factor 1
  KO
K12330  Rho guanine nucleotide exchange factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04270  Vascular smooth muscle contraction
hsa04611  Platelet activation
hsa04810  Regulation of actin cytoskeleton
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05130  Pathogenic Escherichia coli infection
hsa05135  Yersinia infection
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
Network
nt06124  Chemokine signaling (viruses)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00405  CXCR4-GNA12/13-Rho signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
N01088  Escherichia EspH to LPA-GNA12/13-RhoA signaling pathway
N01097  LPA-GNA12/13-RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    9138 (ARHGEF1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    9138 (ARHGEF1)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    9138 (ARHGEF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    9138 (ARHGEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    9138 (ARHGEF1)
   05205 Proteoglycans in cancer
    9138 (ARHGEF1)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    9138 (ARHGEF1)
   05135 Yersinia infection
    9138 (ARHGEF1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    9138 (ARHGEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9138 (ARHGEF1)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    9138 (ARHGEF1)
SSDB
Motif
Pfam: RGS-like PH_16 RhoGEF PH_13 AbiJ_NTD3
Other DBs
NCBI-GeneID: 9138
NCBI-ProteinID: NP_004697
OMIM: 601855
HGNC: 681
Ensembl: ENSG00000076928
Vega: OTTHUMG00000182679
Pharos: Q92888(Tbio)
UniProt: Q92888 A0A024R0R1
LinkDB
Structure
PDB: 

Position
19q13.2
AA seq 912 aa
MEDFARGAASPGPSRPGLVPVSIIGAEDEDFENELETNSEEQNSQFQSLEQVKRRPAHLM
ALLQHVALQFEPGPLLCCLHADMLGSLGPKEAKKAFLDFYHSFLEKTAVLRVPVPPNVAF
ELDRTRADLISEDVQRRFVQEVVQSQQVAVGRQLEDFRSKRLMGMTPWEQELAQLEAWVG
RDRASYEARERHVAERLLMHLEEMQHTISTDEEKSAAVVNAIGLYMRHLGVRTKSGDKKS
GRNFFRKKVMGNRRSDEPAKTKKGLSSILDAARWNRGEPQVPDFRHLKAEVDAEKPGATD
RKGGVGMPSRDRNIGAPGQDTPGVSLHPLSLDSPDREPGADAPLELGDSSPQGPMSLESL
APPESTDEGAETESPEPGDEGEPGRSGLELEPEEPPGWRELVPPDTLHSLPKSQVKRQEV
ISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIFPSLDELIEVHSLFLDRLMK
RRQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFV
QEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILH
HVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTK
DKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVAT
DHKAFYVLFTWDQEAQIYELVAQTVSERKNWCALITETAGSLKVPAPASRPKPRPSPSST
REPLLSSSENGNGGRETSPADARTERILSDLLPFCRPGPEGQLAATALRKVLSLKQLLFP
AEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCRLRPLLSQ
LGGNSVPQPGCT
NT seq 2739 nt   +upstreamnt  +downstreamnt
atggaagacttcgcccgaggggcggcctccccaggcccctcccggcctggcctggttccc
gtcagcatcatcggggctgaggatgaggattttgagaacgagctggagacaaactcagaa
gagcaaaacagccagttccagagcctggagcaggtgaagcggcgcccagcccacctcatg
gccctcctgcagcacgtggccctgcagtttgagccaggacccctgctttgctgtctgcat
gccgacatgctgggctcactgggccccaaggaggccaagaaggccttcctggacttctac
cacagcttcctggagaagacagcggttctccgggtgccggtccctcccaacgtcgccttt
gaacttgaccgcactagggctgacctcatctccgaggatgtccagcggcggttcgtgcag
gaggtggtgcaaagccagcaggtagccgtgggccggcagctggaggacttccgttccaag
cggctcatgggcatgacgccctgggagcaggagctggcccagctggaggcttgggttggg
cgggaccgagccagctacgaggcccgggagcggcacgtggcggagcggctgctcatgcac
ctggaggagatgcaacataccatctctaccgacgaagaaaagagtgctgccgtggtcaac
gccattggcctgtacatgcgccaccttggggtgcggaccaagagtggagacaagaagtcg
gggaggaacttcttccggaaaaaggtgatggggaaccggcggtcggacgagcctgccaag
accaagaaggggctgagcagcatcctggatgccgcccgctggaaccggggagagccccag
gttccagattttcgacacctcaaagcagaggttgatgccgagaagccaggtgctacagac
cggaagggaggcgtggggatgccctctcgggaccggaatatcggggctcctgggcaggac
acccctggagtctctctgcaccctctgtccctggacagcccagaccgggaaccaggtgct
gacgcccccctggagctgggggactcatccccgcagggcccaatgagcctggagtccttg
gcgcccccagagagtaccgacgagggggccgaaaccgagagccccgagcctggagatgag
ggggagccggggcggtcgggactggagcttgaaccagaagagcctcccggctggcgggaa
ctcgtccccccagacaccctgcacagcctgcccaagagccaggtgaagcggcaggaggtc
atcagcgagctgctggtgacagaggcggcccacgtgcgcatgctgcgggtgctgcacgac
ctcttcttccagcccatggcagaatgcctgttcttccccttggaggagctgcagaacatc
ttccccagcctggacgagctcatcgaggtgcattccctgttcctcgatcgcctgatgaag
cggaggcaggagagtggctacctcatcgaggagatcggagacgtgctgctggcccggttt
gatggtgctgagggctcctggttccagaaaatctcctcccgcttctgcagccgccagtca
tttgccttagagcagctcaaagccaagcaacgcaaggaccctcggttctgtgccttcgtg
caggaagctgagagccgcccgcggtgccgccgcctgcagctgaaggacatgatccccacg
gagatgcagcggctgaccaagtaccccctgctcctgcagagcatcgggcagaacacagaa
gagcccacagaacgggagaaagtggagctggcagccgagtgctgccgggaaattctacac
cacgtcaaccaagccgtgcgtgacatggaggacctgctgaggctcaaggactatcagcgg
cgcctggacttgtcccaccttcggcagagcagcgaccctatgctgagcgagttcaagaac
ctggacatcaccaagaagaaattggtccacgagggcccactgacgtggcgggtgactaag
gacaaggcagtggaggtgcatgtgctgctgctggacgacctgctgctgctgctccagcgc
caggacgagcggctgctgctcaagtcccatagccggacactgacgcccacgcccgatggc
aagaccatgctgcggcccgtgctgcggctcacctccgccatgacccgcgaggtggccacc
gatcacaaagccttctacgtcctttttacctgggaccaggaggcccagatatacgagctg
gtggcacagactgtgtcggagcggaaaaactggtgtgctctcatcactgagactgccgga
tccctgaaagtccctgcccctgcctctcgccctaagccccggcccagcccgagcagcacc
cgagaacccctcctcagcagctctgagaacggcaatggtggccgagagacgtctccagct
gatgcccggaccgagagaatcctcagtgacctcctgcccttctgcagaccaggccccgag
ggccagctcgctgccacggcccttcggaaagtgctgtccctgaagcagcttctgtttccg
gcggaggaagacaatggggcggggcctcctcgagatggggatggggtcccagggggcggc
cccctgagcccagcacggacccaggaaatccaggagaacctgctcagcttggaggagacc
atgaagcagctggaggagttggaggaggaattttgccgcctgagacccctcctgtctcag
cttggggggaactctgtcccccagcctggctgcacttga

KEGG   Homo sapiens (human): 9826
Entry
9826              CDS       T01001                                 

Gene name
ARHGEF11, GTRAP48, PDZ-RHOGEF
Definition
(RefSeq) Rho guanine nucleotide exchange factor 11
  KO
K12331  Rho guanine nucleotide exchange factor 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04270  Vascular smooth muscle contraction
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05130  Pathogenic Escherichia coli infection
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01097  LPA-GNA12/13-RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    9826 (ARHGEF11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    9826 (ARHGEF11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    9826 (ARHGEF11)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    9826 (ARHGEF11)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    9826 (ARHGEF11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9826 (ARHGEF11)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    9826 (ARHGEF11)
SSDB
Motif
Pfam: RGS-like PH_16 RhoGEF PDZ PDZ_6 PDZ_2 RGS PH_13 PH
Other DBs
NCBI-GeneID: 9826
NCBI-ProteinID: NP_055599
OMIM: 605708
HGNC: 14580
Ensembl: ENSG00000132694
Vega: OTTHUMG00000041292
Pharos: O15085(Tbio)
UniProt: O15085
LinkDB
Structure
PDB: 

Position
1q23.1
AA seq 1522 aa
MSVRLPQSIDRLSSLSSLGDSAPERKSPSHHRQPSDASETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSMGISGLQQDPSPAGAPRITSVIPSPPPPPPLPPPQRITGPKPLQDPEVQKHATQ
ILRNMLRQEEKELQDILPLYGDTSQRPSEGRLSLDSQEGDSGLDSGTERFPSLSESLMNR
NSVLSDPGLDSPRTSPVIMARVAQHHRRQGSDAAVPSTGDQGVDQSPKPLIIGPEEDYDP
GYFNNESDIIFQDLEKLKSRPAHLGVFLRYIFSQADPSPLLFYLCAEVYQQASPKDSRSL
GKDIWNIFLEKNAPLRVKIPEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYR
TKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYM
SHAGIRLREARPSNTAEKAQSAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYI
GKPKSSSQSTFHIPLSPVEVKPGNVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLES
DSSRSEIRLGRSESLKGREEMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSTSSLS
TRSLENPTPPFTPKMGRRSIESPSLGFCTDTLLPHLLEDDLGQLSDLEPEPDAQNWQHTV
GKDVVAGLTQREIDRQEVINELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFP
NLPELIEIHNSWCEAMKKLREEGPIIKEISDLMLARFDGPAREELQQVAAQFCSYQSIAL
ELIKTKQRKESRFQLFMQEAESHPQCRRLQLRDLIISEMQRLTKYPLLLESIIKHTEGGT
SEHEKLCRARDQCREILKYVNEAVKQTENRHRLEGYQKRLDATALERASNPLAAEFKSLD
LTTRKMIHEGPLTWRISKDKTLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTAVGSSDSKQ
TFSPVLKLNAVLIRSVATDKRAFFIICTSKLGPPQIYELVALTSSDKNTWMELLEEAVRN
ATRHPGAAPMPVHPPPPGPREPAQQGPTPSRVELDDSDVFHGEPEPEELPGGTGSQQRVQ
GKHQVLLEDPEQEGSAEEEELGVLPCPSTSLDGENRGIRTRNPIHLAFPGPLFMEGLADS
ALEDVENLRHLILWSLLPGHTMETQAAQEPEDDLTPTPSVISVTSHPWDPGSPGQAPPGG
EGDNTQLAGLEGERPEQEDMGLCSLEHLPPRTRNSGIWESPELDRNLAEDASSTEAAGGY
KVVRKAEVAGSKVVPALPESGQSEPGPPEVEGGTKATGNCFYVSMPSGPPDSSTDHSEAP
MSPPQPDSLPAGQTEPQPQLQGGNDDPRRPSRSPPSLALRDVGMIFHTIEQLTLKLNRLK
DMELAHRELLKSLGGESSGGTTPVGSFHTEAARWTDGSLSPPAKEPLASDSRNSHELGPC
PEDGSDAPLEDSTADAAASPGP
NT seq 4569 nt   +upstreamnt  +downstreamnt
atgagtgtaaggttaccccagagtatagacaggttaagtagcctgtcttctctgggagat
tctgcaccagagcgcaagtccccttcccaccatcgccagccttcggatgcctctgagaca
acaggtctcgttcaacgctgtgtcattatccaaaaggaccagcatggcttcggcttcaca
gtcagtggggatcgcattgttctggtgcagtctgtgcggcctggaggtgcagccatgaag
gccggtgtgaaagagggcgaccggatcatcaaagtcaacggcaccatggtgaccaatagc
tcacacctggaagtggtaaagctgatcaaatctggcgcctatgtcgcactcaccctcctg
ggctcttcaccttcatccatgggcatctctgggctccagcaggacccatccccagcagga
gctccccgaatcacgtcagtgatcccctcaccaccacctcctccacctctaccacctcca
caacgcatcacaggacccaaacctctgcaggatcccgaagttcaaaaacatgccacccag
atcctcaggaatatgctgaggcaggaagaaaaagaattacaggacatacttccactatat
ggtgacaccagccagagaccatcagaaggccggctctctctggattcccaggagggggac
agtggcttggactctgggacagaacgctttccttccctcagtgagtcattgatgaatcgg
aactcggtactgtcagaccctgggctagacagtcctcgaacctcccctgtgatcatggcc
agggtggcccagcaccacaggcggcagggctcggatgcagcagtcccctcaaccggtgac
cagggtgtagatcaaagcccaaagcctttaattattggcccagaggaagactatgacccg
ggttatttcaacaacgagagcgacatcatattccaggatctggagaaactgaagtctcgg
ccagctcacctgggggtttttctacgttacatcttctctcaggcggaccccagtccactg
cttttttacctgtgtgcagaagtttatcagcaggcaagccccaaggattcccgaagcttg
gggaaagacatctggaatattttcctggagaaaaatgcgcctctgagagtgaagatccct
gagatgctacaggctgaaattgactcgcgcctgcggaacagcgaagatgcccgtggtgtt
ctctgtgaagctcaagaggcagccatgcctgagatccaagagcagatccacgactacaga
acgaagcgcacactggggctgggcagcctgtatggtgaaaatgacctgctggacctggat
ggggaccctctccgagagcgccaagtggctgagaagcagctggctgcccttggagatatt
ttgtccaagtatgaggaagacaggagcgcccccatggacttcgccctcaatacctacatg
agccatgctgggatccgtcttcgagaggcacgaccttccaacacagctgaaaaggcccag
tctgctcctgacaaggacaagtggctaccgttcttccctaagaccaagaagagcagcaat
tccaagaaagaaaaggatgccttggaggacaagaagcgaaaccctatcctcaaatacatt
gggaagcccaaaagctcttctcaaagcacatttcatattcccttgtcccctgtggaagtc
aaaccaggcaatgtgaggaacatcattcagcactttgagaacaaccagcagtatgatgcc
ccagaacctgggacacaacgactctcgaccggaagctttcctgaggacctgctggagagt
gacagttcacgctcagagattcgcctgggccgctctgaaagcctcaagggccgggaagag
atgaaacggtctcgaaaggcagagaacgtgccccgctctcgcagtgatgttgacatggat
gctgctgcggaggctactcgcctgcaccagtcagcctcgtcctctacctccagcctctcc
accaggtctcttgagaacccaacccctccattcactcccaaaatgggccgcaggagcatt
gagtcccccagtttggggttctgcacagataccctccttccccacctcctagaggatgat
ctgggccagctgtctgacctggagccagagccagatgcccaaaattggcagcatacagtg
ggcaaggatgtggtggctgggctaacccagcgggagattgaccggcaagaggtcatcaat
gagctgtttgtgactgaagcttcccacctgcgcacactccgggtcctggacctgatcttc
taccagcgaatgaagaaggagaacctgatgccccgggaggagctggcccggctcttcccg
aacctgcctgaactcatagagattcacaattcctggtgtgaagccatgaagaagctccgg
gaggaaggccccatcatcaaagagatcagtgacctcatgctggcccggtttgatggccct
gcccgagaggaactccagcaagtggctgcacagttctgttcctatcagtcaatagcccta
gagctaatcaagaccaagcaacgcaaggagagtcgattccagctcttcatgcaggaggct
gagagccaccctcagtgtcggcggctgcagctgagagacctcatcatctctgagatgcag
cggctcaccaagtacccgctgctgctggagagcatcatcaagcacacagagggtggcacc
tctgagcatgagaagctgtgccgggcccgggaccagtgccgggagattctcaagtatgtg
aatgaagcggtaaaacaaacagagaaccgccaccgtttagagggctaccagaaacgcctg
gatgccaccgccctggagagggccagcaaccccctggcagcagagttcaagagcctggat
cttacaaccagaaaaatgatccatgagggacccctgacctggaggatcagcaaggataag
accttggacctccacgtgctgctgctggaggacctcctagtgctgctacagaaacaggat
gagaagctattgctgaagtgccacagcaagactgctgtgggctcctcagacagcaagcag
accttcagccccgtgctcaagctcaatgctgtgctcatccgctctgtggccacagataaa
cgggccttcttcatcatctgcacctccaagctgggcccaccccagatctatgagctggtt
gcattgacgtcatcagacaagaacacatggatggagctcttagaagaggccgtgcggaat
gccaccaggcaccccggagctgccccaatgcccgtccatcctccacccccaggtccccgg
gagccagcccagcagggccccacacccagcagggtagaactggatgactcagacgtgttc
catggtgaacctgaacctgaggagctgcctggaggcactgggtcccagcagagggtccaa
gggaagcaccaggtcctgctagaggaccctgagcaggagggcagtgcagaggaagaggaa
ctgggtgtcctgccttgcccttccacatccctggatggagagaacaggggcatcaggaca
aggaaccccatccacttggccttcccaggccctctgttcatggaagggctcgctgactcc
gctctggaagatgtggagaacctgcgacatctgatcctgtggagcctgctgccaggtcac
accatggaaactcaggctgcccaggagcccgaggacgacctgacacccacaccttctgtc
atcagcgtcacctctcacccctgggacccaggctccccagggcaagcaccccctgggggt
gaaggggacaacacccagcttgcagggctggagggggaacggccagagcaggaagacatg
ggtctctgttctctggaacacctacccccaaggaccagaaattctgggatatgggagtct
ccagaactggacaggaatctggctgaagatgcttcaagcacagaggcagcaggaggttac
aaagttgtgagaaaagctgaggtggcaggcagcaaggttgtccctgcactaccagagagt
ggccagtcagagcctgggccacctgaagtggaaggcggaacaaaggctacggggaactgc
ttttatgtcagcatgccatcaggacccccggactcaagcaccgaccactcagaggcaccc
atgagcccccctcagcctgacagcctccctgcagggcagacagagcctcagcctcagctg
cagggaggcaacgatgatccaagacgccccagccgctctcctccaagcctggccctcagg
gacgtgggcatgatcttccataccattgagcagctcactctcaagctcaacaggctcaag
gatatggagctggcccacagagagctgctcaagtcccttgggggagagtcatctggtggc
accacgcctgtgggcagtttccacacagaagcagctagatggacagatggctccctctca
cctcccgctaaggagcccctagcttctgactccaggaacagccatgaactggggccctgc
cctgaggatggctctgacgcccccctggaagacagcacagcagacgcagccgcgtcacca
ggaccataa

DBGET integrated database retrieval system