KEGG   Homo sapiens (human): 112399Help
Entry
112399            CDS       T01001                                 

Gene name
EGLN3, HIFP4H3, HIFPH3, PHD3
Definition
(RefSeq) egl-9 family hypoxia inducible factor 3
  KO
K09592  hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04066  HIF-1 signaling pathway
hsa05200  Pathways in cancer
hsa05211  Renal cell carcinoma
Drug target
Daprodustat: D10874
Enarodustat: D11523
Molidustat sodium: D11273
Roxadustat: D10593
Vadadustat: D11078
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    112399 (EGLN3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112399 (EGLN3)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    112399 (EGLN3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     112399 (EGLN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy_4
Motif
Other DBs
NCBI-GeneID: 112399
NCBI-ProteinID: NP_071356
OMIM: 606426
HGNC: 14661
Ensembl: ENSG00000129521
Vega: OTTHUMG00000029498
Pharos: Q9H6Z9(Tchem)
UniProt: Q9H6Z9
LinkDB All DBs
Position
14q13.1
AA seq 239 aa AA seqDB search
MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQ
LAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKA
MVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEP
IFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALTED
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgggacacatcatgaggctggacctggagaaaattgccctggagtacatcgtg
ccctgtctgcacgaggtgggcttctgctacctggacaacttcctgggcgaggtggtgggc
gactgcgtcctggagcgcgtcaagcagctgcactgcaccggggccctgcgggacggccag
ctggcggggccgcgcgccggcgtctccaagcgacacctgcggggcgaccagatcacgtgg
atcgggggcaacgaggagggctgcgaggccatcagcttcctcctgtccctcatcgacagg
ctggtcctctactgcgggagccggctgggcaaatactacgtcaaggagaggtctaaggca
atggtggcttgctatccgggaaatggaacaggttatgttcgccacgtggacaaccccaac
ggtgatggtcgctgcatcacctgcatctactatctgaacaagaattgggatgccaagcta
catggtgggatcctgcggatatttccagaggggaaatcattcatagcagatgtggagccc
atttttgacagactcctgttcttctggtcagatcgtaggaacccacacgaagtgcagccc
tcttacgcaaccagatatgctatgactgtctggtactttgatgctgaagaaagggcagaa
gccaaaaagaaattcaggaatttaactaggaaaactgaatctgccctcactgaagactga

DBGET integrated database retrieval system