KEGG   Homo sapiens (human): 11255
Entry
11255             CDS       T01001                                 

Gene name
HRH3, GPCR97, HH3R
Definition
(RefSeq) histamine receptor H3
  KO
K04151  histamine receptor H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Bavisant (DG02043): D09870 D09871
Betahistine (DG01004): D01592<JP> D03102 D07522
Cipralisant maleate: D03518
Histamine: D08040
Histamine phosphate: D04445<US>
Irdabisant (DG01330): D10128 D10129
Pitolisant (DG03021): D10749 D11490<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11255 (HRH3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    11255 (HRH3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Histamine
    11255 (HRH3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 DUF3367 7TM_GPCR_Srx DUF621
Other DBs
NCBI-GeneID: 11255
NCBI-ProteinID: NP_009163
OMIM: 604525
HGNC: 5184
Ensembl: ENSG00000101180
Vega: OTTHUMG00000032899
Pharos: Q9Y5N1(Tclin)
UniProt: Q9Y5N1
LinkDB
Position
20q13.33
AA seq 445 aa
MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS
SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA
GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL
AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR
RAFTKLLCPQKLKIQPHSSLEHCWK
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggagcgcgcgccgcccgacgggccgctgaacgcttcgggggcgctggcgggcgaggcg
gcggcggcgggcggggcgcgcggcttctcggcagcctggaccgcggtgctggccgcgctc
atggcgctgctcatcgtggccacggtgctgggcaacgcgctggtcatgctcgccttcgtg
gccgactcgagcctccgcacccagaacaacttcttcctgctcaacctcgccatctccgac
ttcctcgtcggcgccttctgcatcccactgtatgtaccctacgtgctgacaggccgctgg
accttcggccggggcctctgcaagctgtggctggtagtggactacctgctgtgcacctcc
tctgccttcaacatcgtgctcatcagctacgaccgcttcctgtcggtcacccgagcggtc
tcataccgggcccagcagggtgacacgcggcgggcagtgcggaagatgctgctggtgtgg
gtgctggccttcctgctgtacggaccagccatcctgagctgggagtacctgtccgggggc
agctccatccccgagggccactgctatgccgagttcttctacaactggtacttcctcatc
acggcttccaccctggagttctttacgcccttcctcagcgtcaccttctttaacctcagc
atctacctgaacatccagaggcgcacccgcctccggctggatggggctcgagaggcagcc
ggccccgagccccctcccgaggcccagccctcaccacccccaccgcctggctgctggggc
tgctggcagaaggggcacggggaggccatgccgctgcacaggtatggggtgggtgaggcg
gccgtaggcgctgaggccggggaggcgaccctcgggggtggcggtgggggcggctccgtg
gcttcacccacctccagctccggcagctcctcgaggggcactgagaggccgcgctcactc
aagaggggctccaagccgtcggcgtcctcggcctcgctggagaagcgcatgaagatggtg
tcccagagcttcacccagcgctttcggctgtctcgggacaggaaagtggccaagtcgctg
gccgtcatcgtgagcatctttgggctctgctgggccccatacacgctgctgatgatcatc
cgggccgcctgccatggccactgcgtccctgactactggtacgaaacctccttctggctc
ctgtgggccaactcggctgtcaaccctgtcctctaccctctgtgccaccacagcttccgc
cgggccttcaccaagctgctctgcccccagaagctcaaaatccagccccacagctccctg
gagcactgctggaagtga

KEGG   Homo sapiens (human): 3269
Entry
3269              CDS       T01001                                 

Gene name
HRH1, H1-R, H1R, HH1R, hisH1
Definition
(RefSeq) histamine receptor H1
  KO
K04149  histamine receptor H1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04750  Inflammatory mediator regulation of TRP channels
Drug target
Acrivastine: D02760
Alcaftadine: D06552<US>
Alimemazine (DG01101): D02245<JP> D07125
Antazoline (DG01037): D02950 D07458 D07459
Astemizole: D00234
Azatadine (DG01112): D00662 D07482
Azelastine (DG01036): D00659<JP/US> D07483
Bamipine (DG00388): D07197 D07492 D07493
Barmastine: D03056
Bepotastine (DG01327): D01654<JP/US> D09705
Betahistine (DG01004): D01592<JP> D03102 D07522
Bilastine: D09570<JP>
Bisulepin: D07532
Bisulepin hydrochloride: D07533
Broizine: D09838
Bromazine: D03166
Brompheniramine (DG01097): D00663 D07543
Buclizine (DG01104): D02089 D07547
Carbinoxamine (DG01095): D01336<US> D07617 D09808
Cetirizine (DG01107): D00664<JP/US> D07662
Chloropyramine (DG00384): D07195 D07679
Chlorphenamine (DG01099): D00665<JP> D03475 D07398
Chlorphenoxamine (DG00391): D07198 D07684
Chlorpromazine (DG00867): D00270 D00789<JP/US> D03274 D04034<JP> D09819
Cidoxepin hydrochloride: D03491
Cinnarizine (DG01005): D01295 D07734
Clemastine (DG00387): D00666<JP/US> D03535
Closiramine aceturate: D03568
Cycliramine maleate: D03620
Cyclizine (DG01105): D02090 D03621 D03622
Cyproheptadine (DG01109): D02234<JP/US> D07765
Deptropine (DG01114): D07404 D07790
Desloratadine: D03693<JP/US>
Dexbrompheniramine: D03704
Dexchlorpheniramine (DG01098): D00668<JP/US> D07803
Difeterol (DG02077): D01701 D09747 D09748
Dimenhydrinate: D00520<JP/US>
Dimetindene (DG00386): D01343 D07853
Dimetotiazine (DG00843): D01902<JP> D07854
Dioxopromethazine hydrochloride: D07860
Diphenhydramine (DG00390): D00300<JP> D00669<JP/US> D02419 D03285 D03360<JP> D03854
Diphenylimidazole: D02067
Diphenylpyraline (DG01094): D01172 D01627 D07862
Dorastine hydrochloride: D03893
Doxepin (DG00937): D00814<US> D07875
Doxylamine (DG01096): D02327 D07878
Ebastine: D01478<JP>
Efletirizine dihydrochloride: D03963
Embramine: D07889
Emedastine (DG01144): D02249<JP/US> D07890
Epinastine (DG01116): D01713<JP/US> D07900
Esmirtazapine maleate: D04055
Fexofenadine (DG01117): D00671<JP/US> D07958
Histamine: D08040
Histamine phosphate: D04445<US>
Histapyrrodine: D07400
Homochlorcyclizine (DG01328): D01460<JP> D08041
Hydroxyzine (DG00912): D00672<JP/US> D01096<JP/US> D08054
Icotidine: D04494
Isothipendyl (DG00389): D01143 D08091
Ketotifen (DG01115): D01332<JP> D08105
Levocabastine (DG01035): D01717<JP> D08117
Levocetirizine (DG01108): D07402 D08118<JP/US>
Loratadine: D00364<JP>
Mebhydrolin (DG01113): D01786 D08161
Meclozine (DG01106): D01317<US> D08163
Mepyramine (DG00382): D05660 D08183
Mequitazine: D01324<JP>
Methdilazine (DG01103): D04979 D04980
Mizolastine: D01117
Noberastine: D05196
Olanzapine (DG00898): D00454<JP/US> D06623<US>
Olopatadine (DG01039): D01192<JP/US> D08293
Opipramol (DG00930): D01477 D08297
Orphenadrine (DG01252): D08305
Orphenadrine (chloride): D02599
Orphenadrine (citrate): D00774<US>
Oxomemazine: D07401
Phenindamine (DG01110): D02148 D08353
Pheniramine (DG01100): D01174 D08355
Phenyltoloxamine citrate: D08967
Pimethixene: D07406
Promethazine (DG00385): D00480<JP/US> D00494 D01242 D03290<JP> D08432 D08768<JP>
Pyroxamine maleate: D05664
Pyrrobutamine: D07403
Quifenadine: D10230
Rocastine hydrochloride: D05742
Rotoxamine: D05769
Rupatadine (DG01118): D07407 D08497<JP>
Sequifenadine: D10510
Tazifylline hydrochloride: D06012
Tecastemizole: D06021
Temelastine: D06063
Terfenadine: D00521
Tesmilifene hydrochloride: D06084
Thenalidine: D07194
Thonzylamine (DG00381): D01801 D08587
Tolpropamine: D07196
Tripelennamine (DG00383): D02091 D06246 D08645
Triprolidine (DG01111): D01782 D08648
Zolamine hydrochloride: D06376
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3269 (HRH1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3269 (HRH1)
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3269 (HRH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3269 (HRH1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Histamine
    3269 (HRH1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 DUF1601
Other DBs
NCBI-GeneID: 3269
NCBI-ProteinID: NP_000852
OMIM: 600167
HGNC: 5182
Ensembl: ENSG00000196639
Vega: OTTHUMG00000129719
Pharos: P35367(Tclin)
UniProt: P35367
LinkDB
Position
3p25.3
AA seq 487 aa
MSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHT
VGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFI
LCIDRYRSVQQPLRYLKYRTKTRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDKC
ETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCQHRELINRSLPSFSEIKLR
PENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKL
YCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSR
TDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFI
MAAFILCWIPYFIFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFK
RILHIRS
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgagcctccccaattcctcctgcctcttagaagacaagatgtgtgagggcaacaagacc
actatggccagcccccagctgatgcccctggtggtggtcctgagcactatctgcttggtc
acagtagggctcaacctgctggtgctgtatgccgtacggagtgagcggaagctccacact
gtggggaacctgtacatcgtcagcctctcggtggcggacttgatcgtgggtgccgtcgtc
atgcctatgaacatcctctacctgctcatgtccaagtggtcactgggccgtcctctctgc
ctcttttggctttccatggactatgtggccagcacagcgtccattttcagtgtcttcatc
ctgtgcattgatcgctaccgctctgtccagcagcccctcaggtaccttaagtatcgtacc
aagacccgagcctcggccaccattctgggggcctggtttctctcttttctgtgggttatt
cccattctaggctggaatcacttcatgcagcagacctcggtgcgccgagaggacaagtgt
gagacagacttctatgatgtcacctggttcaaggtcatgactgccatcatcaacttctac
ctgcccaccttgctcatgctctggttctatgccaagatctacaaggccgtacgacaacac
tgccagcaccgggagctcatcaataggtccctcccttccttctcagaaattaagctgagg
ccagagaaccccaagggggatgccaagaaaccagggaaggagtctccctgggaggttctg
aaaaggaagccaaaagatgctggtggtggatctgtcttgaagtcaccatcccaaaccccc
aaggagatgaaatccccagttgtcttcagccaagaggatgatagagaagtagacaaactc
tactgctttccacttgatattgtgcacatgcaggctgcggcagaggggagtagcagggac
tatgtagccgtcaaccggagccatggccagctcaagacagatgagcagggcctgaacaca
catggggccagcgagatatcagaggatcagatgttaggtgatagccaatccttctctcga
acggactcagataccaccacagagacagcaccaggcaaaggcaaattgaggagtgggtct
aacacaggcctggattacatcaagtttacttggaagaggctccgctcgcattcaagacag
tatgtatctgggttgcacatgaaccgcgaaaggaaggccgccaaacagttgggttttatc
atggcagccttcatcctctgctggatcccttatttcatcttcttcatggtcattgccttc
tgcaagaactgttgcaatgaacatttgcacatgttcaccatctggctgggctacatcaac
tccacactgaaccccctcatctaccccttgtgcaatgagaacttcaagaagacattcaag
agaattctgcatattcgctcctaa

KEGG   Homo sapiens (human): 3274
Entry
3274              CDS       T01001                                 

Gene name
HRH2, H2R, HH2R
Definition
(RefSeq) histamine receptor H2
  KO
K04150  histamine receptor H2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04971  Gastric acid secretion
Drug target
Betazole: D01187
Cimetidine (DG00017): D00295<JP/US> D03503<US>
Dalcotidine: D01698
Donetidine: D03889
Etintidine hydrochloride: D04098
Famotidine: D00318<JP/US>
Histamine: D08040
Histamine phosphate: D04445<US>
Icotidine: D04494
Impromidine hydrochloride: D04517
Lafutidine: D01131<JP>
Lavoltidine succinate: D04680
Lupitidine hydrochloride: D04794
Methantheline (DG00036): D00721
Metiamide: D05004
Niperotidine: D07072
Nizatidine: D00440<JP/US>
Osutidine: D01193
Oxmetidine (DG01225): D05306 D05307
Pibutidine hydrochloride: D01861
Ranitidine (DG00018): D00422 D00673<JP/US>
Ranitidine bismuth citrate: D05699
Roxatidine (DG00019): D01467<JP> D08494 D08495
Sufotidine: D05939
Tiotidine: D06157
Zaltidine hydrochloride: D06355
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3274 (HRH2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3274 (HRH2)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    3274 (HRH2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3274 (HRH2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Histamine
    3274 (HRH2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 3274
NCBI-ProteinID: NP_001124527
OMIM: 142703
HGNC: 5183
Ensembl: ENSG00000113749
Vega: OTTHUMG00000130660
Pharos: P25021(Tclin)
UniProt: P25021
LinkDB
Position
5q35.2
AA seq 397 aa
MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL
AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM
GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ
QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDRP
WLCLPECWSVELTHSFIHLFIHSFANIHPIPTTCQEL
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcacccaatggcacagcctcttccttttgcctggactctaccgcatgcaagatcacc
atcaccgtggtccttgcggtcctcatcctcatcaccgttgctggcaatgtggtcgtctgt
ctggccgtgggcttgaaccgccggctccgcaacctgaccaattgtttcatcgtgtccttg
gctatcactgacctgctcctcggcctcctggtgctgcccttctctgccatctaccagctg
tcctgcaagtggagctttggcaaggtcttctgcaatatctacaccagcctggatgtgatg
ctctgcacagcctccattcttaacctcttcatgatcagcctcgaccggtactgcgctgtc
atggacccactgcggtaccctgtgctggtcaccccagttcgggtcgccatctctctggtc
ttaatttgggtcatctccattaccctgtcctttctgtctatccacctggggtggaacagc
aggaacgagaccagcaagggcaatcataccacctctaagtgcaaagtccaggtcaatgaa
gtgtacgggctggtggatgggctggtcaccttctacctcccgctactgatcatgtgcatc
acctactaccgcatcttcaaggtcgcccgggatcaggccaagaggatcaatcacattagc
tcctggaaggcagccaccatcagggagcacaaagccacagtgacactggccgccgtcatg
ggggccttcatcatctgctggtttccctacttcaccgcgtttgtgtaccgtgggctgaga
ggggatgatgccatcaatgaggtgttagaagccatcgttctgtggctgggctatgccaac
tcagccctgaaccccatcctgtatgctgcgctgaacagagacttccgcaccgggtaccaa
cagctcttctgctgcaggctggccaaccgcaactcccacaaaacttctctgaggtccaac
gcctctcagctgtccaggacccaaagccgagaacccaggcaacaggaagagaaacccctg
aagctccaggtgtggagtgggacagaagtcacggccccccagggagccacagacagacca
tggctttgccttccagaatgctggtctgtggaactgacccattcattcattcatttgttc
attcattcatttgcaaacattcatccaattcccaccacatgccaggaattatga

KEGG   Homo sapiens (human): 59340
Entry
59340             CDS       T01001                                 

Gene name
HRH4, AXOR35, BG26, GPCR105, GPRv53, H4, H4R, HH4R
Definition
(RefSeq) histamine receptor H4
  KO
K04152  histamine receptor H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Adriforant: D11819
Histamine: D08040
Toreforant (DG01866): D10735 D10736
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    59340 (HRH4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    59340 (HRH4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Histamine
    59340 (HRH4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 MPS-4
Other DBs
NCBI-GeneID: 59340
NCBI-ProteinID: NP_067637
OMIM: 606792
HGNC: 17383
Ensembl: ENSG00000134489
Vega: OTTHUMG00000131945
Pharos: Q9H3N8(Tchem)
UniProt: Q9H3N8
LinkDB
Position
18q11.2
AA seq 390 aa
MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgccagatactaatagcacaatcaatttatcactaagcactcgtgttactttagcattt
tttatgtccttagtagcttttgctataatgctaggaaatgctttggtcattttagctttt
gtggtggacaaaaaccttagacatcgaagtagttatttttttcttaacttggccatctct
gacttctttgtgggtgtgatctccattcctttgtacatccctcacacgctgttcgaatgg
gattttggaaaggaaatctgtgtattttggctcactactgactatctgttatgtacagca
tctgtatataacattgtcctcatcagctatgatcgatacctgtcagtctcaaatgctgtg
tcttatagaactcaacatactggggtcttgaagattgttactctgatggtggccgtttgg
gtgctggccttcttagtgaatgggccaatgattctagtttcagagtcttggaaggatgaa
ggtagtgaatgtgaacctggatttttttcggaatggtacatccttgccatcacatcattc
ttggaattcgtgatcccagtcatcttagtcgcttatttcaacatgaatatttattggagc
ctgtggaagcgtgatcatctcagtaggtgccaaagccatcctggactgactgctgtctct
tccaacatctgtggacactcattcagaggtagactatcttcaaggagatctctttctgca
tcgacagaagttcctgcatcctttcattcagagagacagaggagaaagagtagtctcatg
ttttcctcaagaaccaagatgaatagcaatacaattgcttccaaaatgggttccttctcc
caatcagattctgtagctcttcaccaaagggaacatgttgaactgcttagagccaggaga
ttagccaagtcactggccattctcttaggggtttttgctgtttgctgggctccatattct
ctgttcacaattgtcctttcattttattcctcagcaacaggtcctaaatcagtttggtat
agaattgcattttggcttcagtggttcaattcctttgtcaatcctcttttgtatccattg
tgtcacaagcgctttcaaaaggctttcttgaaaatattttgtataaaaaagcaacctcta
ccatcacaacacagtcggtcagtatcttcttaa

DBGET integrated database retrieval system