KEGG   Homo sapiens (human): 11258
Entry
11258             CDS       T01001                                 

Gene name
DCTN3, DCTN-22, DCTN22
Definition
(RefSeq) dynactin subunit 3
  KO
K10425  dynactin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
N01295  Rab7-regulated microtubule minus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    11258 (DCTN3)
   05016 Huntington disease
    11258 (DCTN3)
   05022 Pathways of neurodegeneration - multiple diseases
    11258 (DCTN3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    11258 (DCTN3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    11258 (DCTN3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    11258 (DCTN3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     11258 (DCTN3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     11258 (DCTN3)
SSDB
Motif
Pfam: Dynactin_p22 DUF4011 Spidroin_MaSp DivIC Tox-HNH-HHH
Other DBs
NCBI-GeneID: 11258
NCBI-ProteinID: NP_009165
OMIM: 607387
HGNC: 2713
Ensembl: ENSG00000137100
Vega: OTTHUMG00000019830
Pharos: O75935(Tdark)
UniProt: O75935
LinkDB
Position
9p13.3
AA seq 186 aa
MAGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKK
IEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVP
EHAARLQRLAQIHIQQQDQCVEITEESKALLEEYNKTTMLLSKQFVQWDELLCQLEAATQ
VKPAEE
NT seq 561 nt   +upstreamnt  +downstreamnt
atggcgggtctgactgacttgcagcggctacaggcccgagtggaagagctggagcgctgg
gtgtacgggccgggcggggcgcgcggctcacggaaggtggctgacggcctggtcaaggtg
caggtggctttggggaacatttccagcaagagggagagggtgaagattctctacaaaaag
attgaagatctgatcaagtacctggatcctgagtacatcgaccgcattgccatacctgat
gcctctaagctgcaattcatcctagcagaggagcagtttatcctttcccaggttgcactc
ctggagcaggtgaatgccttggtgcccatgctggacagtgctcacatcaaagccgttcct
gagcatgctgcccgcctgcagcgcttggcccagatccacattcagcagcaggaccagtgt
gtggaaatcactgaggagtccaaggctctcctggaggaatacaacaagactacaatgctt
ctctccaagcaattcgtgcagtgggatgagctactttgccagctagaggccgccacgcaa
gtgaagccagcagaggagtga

DBGET integrated database retrieval system