KEGG   Homo sapiens (human): 113026Help
Entry
113026            CDS       T01001                                 

Gene name
PLCD3, PLC-delta-3
Definition
(RefSeq) phospholipase C delta 3
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04919  Thyroid hormone signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    113026 (PLCD3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    113026 (PLCD3)
   04070 Phosphatidylinositol signaling system
    113026 (PLCD3)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    113026 (PLCD3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113026 (PLCD3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    113026 (PLCD3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     113026 (PLCD3)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    113026 (PLCD3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    113026 (PLCD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_10 EF-hand_like C2 S_100 PH EF-hand_7 SPARC_Ca_bdg TEP1_N
Motif
Other DBs
NCBI-GeneID: 113026
NCBI-ProteinID: NP_588614
OMIM: 608795
HGNC: 9061
Ensembl: ENSG00000161714
Vega: OTTHUMG00000168029
Pharos: Q8N3E9(Tbio)
UniProt: Q8N3E9
LinkDB All DBs
Position
17q21.31
AA seq 789 aa AA seqDB search
MLCGRWRRCRRPPEEPPVAAQVAAQVAAPVALPSPPTPSDGGTKRPGLRALKKMGLTEDE
DVRAMLRGSRLRKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAPSQHIFFVQHIEAVREG
HQSEGLRRFGGAFAPARCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLTKLRARLDAMSQR
ERLDHWIHSYLHRADSNQDSKMSFKEIKSLLRMVNVDMNDMYAYLLFKECDHSNNDRLEG
AEIEEFLRRLLKRPELEEIFHQYSGEDRVLSAPELLEFLEDQGEEGATLARAQQLIQTYE
LNETAKQHELMTLDGFMMYLLSPEGAALDNTHTCVFQDMNQPLAHYFISSSHNTYLTDSQ
IGGPSSTEAYVRAFAQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVVQAVRDHAFT
LSPYPVILSLENHCGLEQQAAMARHLCTILGDMLVTQALDSPNPEELPSPEQLKGRVLVK
GKKLPAARSEDGRALSDREEEEEDDEEEEEEVEAAAQRRLAKQISPELSALAVYCHATRL
RTLHPAPNAPQPCQVSSLSERKAKKLIREAGNSFVRHNARQLTRVYPLGLRMNSANYSPQ
EMWNSGCQLVALNFQTPGYEMDLNAGRFLVNGQCGYVLKPACLRQPDSTFDPEYPGPPRT
TLSIQVLTAQQLPKLNAEKPHSIVDPLVRIEIHGVPADCARQETDYVLNNGFNPRWGQTL
QFQLRAPELALVRFVVEDYDATSPNDFVGQFTLPLSSLKQGYRHIHLLSKDGASLSPATL
FIQIRIQRS
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcggccgctggaggcgttgccgccgcccgcccgaggagcccccggtggccgcc
caggtcgcagcccaagtcgcggcgccggtcgctctcccgtccccgccgactccctccgat
ggcggcaccaagaggcccgggctgcgggcgctgaagaagatgggcctgacggaggacgag
gacgtgcgcgccatgctgcggggctcccggctccgcaagatccgctcgcgcacgtggcac
aaggagcggctgtaccggctgcaggaggacggcctgagcgtgtggttccagcggcgcatc
ccgcgtgcgccatcgcagcacatcttcttcgtgcagcacatcgaggcggtccgcgagggc
caccagtccgagggcctgcggcgcttcgggggtgccttcgcgccagcgcgctgcctcacc
atcgccttcaagggccgccgcaagaacctggacctggcggcgcccacggctgaggaagcg
cagcgctgggtgcgcggtctgaccaagctccgcgcgcgcctggacgccatgagccagcgc
gagcggctagaccactggatccactcctatctgcaccgggctgactccaaccaggacagc
aagatgagcttcaaggagatcaagagcctgctgagaatggtcaacgtggacatgaacgac
atgtacgcctacctcctcttcaaggagtgtgaccactccaacaacgaccgtctagagggg
gctgagatcgaggagttcctgcggcggctgctgaagcggccggagctggaggagatcttc
catcagtactcgggcgaggaccgcgtgctgagtgcccctgagctgctggagttcctggag
gaccagggcgaggagggcgccacactggcccgcgcccagcagctcattcagacctatgag
ctcaacgagacagccaagcagcatgagctgatgacactggatggcttcatgatgtacctg
ttgtcgccggagggggctgccttggacaacacccacacgtgtgtgttccaggacatgaac
cagccccttgcccactacttcatctcttcctcccacaacacctatctgactgactcccag
atcggggggcccagcagcaccgaggcctatgttagggcctttgcccagggatgccgctgc
gtggagctggactgctgggaggggccaggaggggagcccgtcatctatcatggccatacc
ctcacctccaagattctcttccgggacgtggtccaagccgtgcgcgaccatgccttcacg
ctgtccccttaccctgtcatcctatccctggagaaccactgcgggctggagcagcaggct
gccatggcccgccacctctgcaccatcctgggggacatgctggtgacacaggcgctggac
tccccaaatcccgaggagctgccatccccagagcagctgaagggccgggtcctggtgaag
ggaaagaagttgcccgctgctcggagcgaggatggccgggctctgtcggatcgggaggag
gaggaggaggatgacgaggaggaagaagaggaggtggaggctgcagcgcagaggcggctg
gccaagcagatctccccggagctgtcggccctggctgtgtactgccacgccacccgcctg
cggaccctgcaccctgcccccaacgccccacaaccctgccaggtcagctccctcagcgag
cgcaaagccaagaaactcattcgggaggcagggaacagctttgtcaggcacaatgcccgc
cagctgacccgcgtgtacccgctggggctgcggatgaactcagccaactacagtccccag
gagatgtggaactcgggctgtcagctggtggccttgaacttccagacgccaggctacgag
atggacctcaatgccgggcgcttcctagtcaatgggcagtgtggctacgtcctaaaacct
gcctgcctgcggcaacctgactcgacctttgaccccgagtacccaggacctcccagaacc
actctcagcatccaggtgctgactgcacagcagctgcccaagctgaatgccgagaagcca
cactccattgtggaccccctggtgcgcattgagatccatggggtgcccgcagactgtgcc
cggcaggagactgactacgtgctcaacaatggcttcaacccccgctgggggcagaccctg
cagttccagctgcgggctccggagctggcactggtccggtttgtggtggaagattatgac
gccacctcccccaatgactttgtgggccagtttacactgcctcttagcagcctaaagcaa
gggtaccgccacatacacctgctttccaaggacggggcctcactgtcaccagccacgctc
ttcatccaaatccgcatccagcgctcctga

KEGG   Homo sapiens (human): 23236Help
Entry
23236             CDS       T01001                                 

Gene name
PLCB1, EIEE12, PI-PLC, PLC-154, PLC-I, PLC-beta-1, PLC154, PLCB1A, PLCB1B
Definition
(RefSeq) phospholipase C beta 1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04062  Chemokine signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04310  Wnt signaling pathway
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04621  NOD-like receptor signaling pathway
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04934  Cushing syndrome
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa05010  Alzheimer disease
hsa05016  Huntington disease
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05146  Amoebiasis
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Network
nt06124  Chemokine signaling (virus)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06316  Angiotensin-aldosterone signaling
nt06318  CaSR-PTH signaling
  Element
N00291  CaSR-PTH signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
N00407  HCMV UL33 to GNAQ-PLCB/G-calcineurin signaling pathway
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
N00428  CCR5-GNB/G-PLCB/G-PKC signaling pathway
N00546  CXCL12-CXCR4-PKC-ERK signaling pathaway
Disease
H00606  Early infantile epileptic encephalopathy
H01815  Malignant migrating partial seizures in infancy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    23236 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    23236 (PLCB1)
   04310 Wnt signaling pathway
    23236 (PLCB1)
   04371 Apelin signaling pathway
    23236 (PLCB1)
   04020 Calcium signaling pathway
    23236 (PLCB1)
   04070 Phosphatidylinositol signaling system
    23236 (PLCB1)
   04072 Phospholipase D signaling pathway
    23236 (PLCB1)
   04071 Sphingolipid signaling pathway
    23236 (PLCB1)
   04022 cGMP-PKG signaling pathway
    23236 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    23236 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    23236 (PLCB1)
   04621 NOD-like receptor signaling pathway
    23236 (PLCB1)
   04062 Chemokine signaling pathway
    23236 (PLCB1)
  09152 Endocrine system
   04911 Insulin secretion
    23236 (PLCB1)
   04922 Glucagon signaling pathway
    23236 (PLCB1)
   04912 GnRH signaling pathway
    23236 (PLCB1)
   04915 Estrogen signaling pathway
    23236 (PLCB1)
   04921 Oxytocin signaling pathway
    23236 (PLCB1)
   04926 Relaxin signaling pathway
    23236 (PLCB1)
   04918 Thyroid hormone synthesis
    23236 (PLCB1)
   04919 Thyroid hormone signaling pathway
    23236 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    23236 (PLCB1)
   04916 Melanogenesis
    23236 (PLCB1)
   04924 Renin secretion
    23236 (PLCB1)
   04925 Aldosterone synthesis and secretion
    23236 (PLCB1)
   04927 Cortisol synthesis and secretion
    23236 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    23236 (PLCB1)
   04270 Vascular smooth muscle contraction
    23236 (PLCB1)
  09154 Digestive system
   04970 Salivary secretion
    23236 (PLCB1)
   04971 Gastric acid secretion
    23236 (PLCB1)
   04972 Pancreatic secretion
    23236 (PLCB1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    23236 (PLCB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    23236 (PLCB1)
   04725 Cholinergic synapse
    23236 (PLCB1)
   04728 Dopaminergic synapse
    23236 (PLCB1)
   04726 Serotonergic synapse
    23236 (PLCB1)
   04720 Long-term potentiation
    23236 (PLCB1)
   04730 Long-term depression
    23236 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    23236 (PLCB1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    23236 (PLCB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    23236 (PLCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    23236 (PLCB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    23236 (PLCB1)
   05016 Huntington disease
    23236 (PLCB1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    23236 (PLCB1)
   04934 Cushing syndrome
    23236 (PLCB1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    23236 (PLCB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    23236 (PLCB1)
   05142 Chagas disease (American trypanosomiasis)
    23236 (PLCB1)
   05143 African trypanosomiasis
    23236 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23236 (PLCB1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     23236 (PLCB1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    23236 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    23236 (PLCB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like DUF1154
Motif
Other DBs
NCBI-GeneID: 23236
NCBI-ProteinID: NP_056007
OMIM: 607120
HGNC: 15917
Ensembl: ENSG00000182621
Vega: OTTHUMG00000031849
Pharos: Q9NQ66(Tbio)
UniProt: Q9NQ66
LinkDB All DBs
Position
20p12.3
AA seq 1216 aa AA seqDB search
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGRHAKAPKDPKLRELLDVGNIGRLEQRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLARKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTYSDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTMDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPTLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSEAPSEARTTPAENGVNHTTTLTPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKSAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSS
EELGGDIPGKEFDTPL
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atggccggggctcaacccggagtgcacgccttgcaactcaagcccgtgtgcgtgtccgac
agcctcaagaagggcaccaaattcgtcaagtgggatgatgactcaactattgttactcca
attattttgaggactgaccctcagggatttttcttttactggacagatcaaaacaaggag
acagagctactggatctcagccttgtcaaagatgccagatgtgggagacacgccaaagct
cccaaggaccccaaattacgtgaacttttggatgtggggaacatcgggcgcctggagcag
cgcatgatcacagtggtgtatgggcctgacctcgtgaacatctcccatttgaatctcgtg
gctttccaagaagaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaac
ctgctggcccaaaacatgtccagggatgcatttctggaaaaagcctatactaaacttaag
ctgcaagtcactccagaagggcgtattcctctcaaaaacatatatcgcttgttttcagca
gatcggaagcgagttgaaactgctttagaggcttgtagtcttccatcttcaaggaatgat
tcaatacctcaagaagatttcactccagaagtgtacagagttttcctcaacaacctttgc
cctcgacctgaaattgataacatcttttcagaatttggtgcaaaaagcaaaccatatctt
accgttgatcagatgatggattttatcaaccttaagcagcgagatcctcggcttaatgaa
atactttatccacctctaaaacaagagcaagtccaagtattgattgagaagtatgaaccc
aacaacagcctcgccagaaaaggacaaatatcagtggatgggttcatgcgctatctgagt
ggagaagaaaacggagtcgtttcacctgagaaactggatttgaatgaagacatgtctcag
cccctttctcactatttcattaattcctcgcacaacacctacctcacagctggccaactg
gctggaaactcctctgttgagatgtatcgccaagtgctcctgtctggttgtcgctgtgtg
gagctggactgctggaagggacggactgcagaagaggaacctgtcatcacccatggcttc
accatgacaactgaaatatctttcaaggaagtgatagaagcaattgcggagtgtgcattt
aagacttcaccttttccaattctcctttcgtttgagaaccatgtggattccccaaagcag
caagccaagatggcggagtactgccgactgatctttggggatgcccttctcatggagccc
ctggaaaaatatccactggaatctggagttcctcttccaagccctatggatttaatgtat
aaaattttggtgaaaaataagaagaaatcacacaagtcatcagaaggaagcggcaaaaag
aagctctcagaacaagcctccaacacctacagtgactcctccagcatgttcgagccctca
tccccaggagccggagaagctgatacggaaagtgacgacgacgatgatgatgatgactgt
aaaaaatcttcaatggatgaggggactgctggaagtgaggctatggccacagaagaaatg
tctaatctggtgaactatattcagccagtcaagtttgagtcatttgaaatttcaaaaaaa
agaaataaaagttttgaaatgtcttccttcgtggaaaccaaaggacttgaacaactcacc
aagtctccagtggaatttgtagaatataacaaaatgcagcttagcaggatatatccaaaa
ggaacacgtgtggattcatccaactatatgcctcagctcttctggaatgcaggttgtcag
atggtggcacttaatttccagacaatggacctggctatgcaaataaatatggggatgtat
gaatacaacgggaagagtggctacagattgaagccagagttcatgaggaggcctgacaag
cattttgatccatttactgaaggcatcgtagatgggatagtggcaaacactttgtctgtt
aagattatttcaggtcagtttctttctgataagaaagttgggacttacgtggaagtagat
atgtttggtttgcctgtggatacaaggaggaaggcatttaagaccaaaacatcccaagga
aatgctgtgaatcctgtctgggaagaagaacctattgtgttcaaaaaggtggttcttcct
actctggcctgtttgagaatagcagtttatgaagaaggaggtaaattcattggccaccgt
atcttgccagtgcaagccattcggccaggctatcactatatctgtctaaggaatgaaagg
aaccagcctctgacgctgcctgctgtctttgtctacatagaagtgaaagactatgtgcca
gacacatatgcagatgtcatcgaagctttatcaaacccaatccgatatgtgaacctgatg
gaacagagagctaagcaattggctgctttgacactggaagatgaagaagaagtaaagaaa
gaggctgatcctggagaaacaccatcagaggctccaagtgaagcgagaacgactccagca
gaaaatggggtgaatcacactacaaccctgacacccaagccaccctcccaggctctccac
agccagccagctccaggttctgtaaaggcacctgccaaaacagaagatcttattcagagt
gtcttaacagaagtggaagcacagaccatcgaagaactaaagcaacagaaatcgtttgtg
aaacttcaaaagaaacactacaaagaaatgaaagacctggttaagagacaccacaagaaa
accactgaccttatcaaagaacacactaccaagtataatgaaattcagaatgactacttg
agaaggagagccgctttggaaaagtccgccaaaaaggacagtaagaaaaaatcggaaccc
agcagccctgatcatggttcatcaacgattgagcaagacctcgctgctctggatgctgaa
atgacccaaaagttaatagacttgaaggacaaacaacagcagcagctgcttaatcttcgg
caagaacagtattatagtgaaaaataccagaagcgagaacatattaaactgcttattcaa
aagttgacggatgtcgcagaagagtgtcagaacaatcagttaaagaagctcaaagaaatc
tgtgagaaagaaaagaaagaattaaagaagaaaatggataaaaagaggcaggagaagata
acagaagctaaatccaaagacaaaagtcagatggaagaggagaagacagagatgatccgg
tcatatatccaggaagtggtgcagtatatcaagaggctagaagaagcgcaaagtaaacgg
caagaaaaactcgtagagaaacacaaggaaatacgtcagcagatcctggatgaaaagccc
aagctgcaggtggagctggagcaagaataccaagacaaattcaaaagactgcccctcgag
attttggaattcgtgcaggaagccatgaaaggaaagatcagtgaagacagcaatcacggt
tctgcccctctctccctgtcctcagaccctggaaaagtgaaccacaagactccctccagt
gaggagctgggaggagacatcccaggaaaagaatttgatactcctctgtga

KEGG   Homo sapiens (human): 51196Help
Entry
51196             CDS       T01001                                 

Gene name
PLCE1, NPHS3, PLCE, PPLC
Definition
(RefSeq) phospholipase C epsilon 1
  KO
K05860  phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04919  Thyroid hormone signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05205  Proteoglycans in cancer
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Disease
H01657  Nephrotic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    51196 (PLCE1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    51196 (PLCE1)
   04015 Rap1 signaling pathway
    51196 (PLCE1)
   04020 Calcium signaling pathway
    51196 (PLCE1)
   04070 Phosphatidylinositol signaling system
    51196 (PLCE1)
   04024 cAMP signaling pathway
    51196 (PLCE1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    51196 (PLCE1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    51196 (PLCE1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    51196 (PLCE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51196 (PLCE1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     51196 (PLCE1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    51196 (PLCE1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    51196 (PLCE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y RasGEF RA C2 EF-hand_like
Motif
Other DBs
NCBI-GeneID: 51196
NCBI-ProteinID: NP_057425
OMIM: 608414
HGNC: 17175
Ensembl: ENSG00000138193
Vega: OTTHUMG00000018789
Pharos: Q9P212(Tbio)
UniProt: Q9P212
LinkDB All DBs
Structure
PDB: 

Position
10q23.33
AA seq 2302 aa AA seqDB search
MTSEEMTASVLIPVTQRKVVSAQSAADESSEKVSDINISKAHTVRRSGETSHTISQLNKL
KEEPSGSNLPKILSIAREKIVSDENSNEKCWEKIMPDSAKNLNINCNNILRNHQHGLPQR
QFYEMYNSVAEEDLCLETGIPSPLERKVFPGIQLELDRPSMGISPLGNQSVIIETGRAHP
DSRRAVFHFHYEVDRRMSDTFCTLSENLILDDCGNCVPLPGGEEKQKKNYVAYTCKLMEL
AKNCDNKNEQLQCDHCDTLNDKYFCFEGSCEKVDMVYSGDSFCRKDFTDSQAAKTFLSHF
EDFPDNCDDVEEDAFKSKKERSTLLVRRFCKNDREVKKSVYTGTRAIVRTLPSGHIGLTA
WSYIDQKRNGPLLPCGRVMEPPSTVEIRQDGSQRLSEAQWYPIYNAVRREETENTVGSLL
HFLTKLPASETAHGRISVGPCLKQCVRDTVCEYRATLQRTSISQYITGSLLEATTSLGAR
SGLLSTFGGSTGRMMLKERQPGPSVANSNALPSSSAGISKELIDLQPLIQFPEEVASILM
EQEQTIYRRVLPVDYLCFLTRDLGTPECQSSLPCLKASISASILTTQNGEHNALEDLVMR
FNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMW
QFMDQSDIETMRSLKDAMAQHESSCEYRKVVTRALHIPGCKVVPFCGVFLKELCEVLDGA
SGLMKLCPRYNSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQVIRSCNRS
LETDEEDSPSEGNSSRKSSLKDKSRWQFIIGDLLDSDNDIFEQSKEYDSHGSEDSQKAFD
HGTELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWVKPTTAS
PASSKAKLGVLNNTAEPGKFPLLGNAGLSSLTEGVLDLFAVKAVYMGHPGIDIHTVCVQN
KLGSMFLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTRAVRKMRKFPDQRQ
QWLRKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSARNPSPGTSAKNAEKPNMQRNNTLG
ISTTKKKKKILMRGESGEVTDDEMATRKAKMHKECRSRSGSDPQDINEQEESEVNAIANP
PNPLPSRRAHSLTTAGSPNLAAGTSSPIRPVSSPVLSSSNKSPSSAWSSSSWHGRIKGGM
KGFQSFMVSDSNMSFVEFVELFKSFSVRSRKDLKDLFDVYAVPCNRSGSESAPLYTNLTI
DENTSDLQPDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLG
IFGVGILQLNDFLVNCQGEHCTYDEILSIIQKFEPSISMCHQGLMSFEGFARFLMDKENF
ASKNDESQENIKELQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDC
WDGDDGMPIIYHGHTLTTKIPFKEVVEAIDRSAFINSDLPIIISIENHCSLPQQRKMAEI
FKTVFGEKLVTKFLFETDFSDDPMLPSPDQLRKKVLLKNKKLKAHQTPVDILKQKAHQLA
SMQVQAYNGGNANPRPANNEEEEDEEDEYDYDYESLSDDNILEDRPENKSCNDKLQFEYN
EEIPKRIKKADNSACNKGKVYDMELGEEFYLDQNKKESRQIAPELSDLVIYCQAVKFPGL
STLNASGSSRGKERKSRKSIFGNNPGRMSPGETASFNKTSGKSSCEGIRQTWEESSSPLN
PTTSLSAIIRTPKCYHISSLNENAAKRLCRRYSQKLTQHTACQLLRTYPAATRIDSSNPN
PLMFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKNCPMYQKFSPLE
RDLDSMDPAVYSLTIVSGQNVCPSNSMGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMW
NEQFLFHVHFEDLVFLRFAVVENNSSAVTAQRIIPLKALKRGYRHLQLRNLHNEVLEISS
LFINSRRMEENSSGNTMSASSMFNTEERKCLQTHRVTVHGVPGPEPFTVFTINGGTKAKQ
LLQQILTNEQDIKPVTTDYFLMEEKYFISKEKNECRKQPFQRAIGPEEEIMQILSSWFPE
EGYMGRIVLKTQQENLEEKNIVQDDKEVILSSEEESFFVQVHDVSPEQPRTVIKAPRVST
AQDVIQQTLCKAKYSYSILSNPNPSDYVLLEEVVKDTTNKKTTTPKSSQRVLLDQECVFQ
AQSKWKGAGKFILKLKEQVQASREDKKKGISFASELKKLTKSTKQPRGLTSPSQLLTSES
IQTKEEKPVGGLSSSDTMDYRQ
NT seq 6909 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgaagaaatgacagcttctgttctcatacctgtgactcagagaaaagtggtt
tctgcccagtcggctgcagatgaaagtagtgaaaaggtctcagacatcaatatttcaaaa
gcacatactgtcagacgaagtggggagacttctcataccatctcacaactgaacaaactt
aaagaagaaccttctggaagcaacttgccaaagattctctcaatagcgagggagaaaata
gtgagtgatgagaacagtaatgaaaaatgttgggagaaaatcatgccagattctgcgaaa
aaccttaacattaactgcaacaacatattgagaaaccatcagcatggccttcctcagaga
caattttatgaaatgtacaactctgttgctgaggaagacttgtgtttagaaactggaatt
ccttctccactggaaagaaaggtgttccctggaattcaactggaactagacagaccttcc
atgggcattagtcctttaggaaatcagtcagtgatcatagagacaggcagagcacaccct
gacagcagaagggcagtatttcattttcattatgaagttgacagaagaatgtcagacact
ttctgtaccctatcagaaaacttaattttagacgattgtggaaattgtgtaccactacct
gggggtgaggagaagcaaaagaaaaactatgtggcatatacctgtaaactgatggaattg
gccaaaaattgtgataataagaatgagcagctgcagtgtgatcattgtgacaccttgaat
gataaatacttttgctttgaaggctcttgtgagaaggttgacatggtatattcaggtgat
agcttttgtaggaaagactttactgacagtcaagctgccaagacctttttgagccatttt
gaggacttccctgataattgtgatgatgtagaagaagacgcttttaaaagcaaaaaggag
cgatccactttgttagtcaggagattctgtaaaaatgacagagaagttaagaaatctgtg
tatactggaacaagagcaattgtgagaactctgccttctggccacattgggctgactgca
tggagttacatagatcagaagagaaatggtcccttactgccttgtgggagagtaatggaa
cccccgtcaacagtggagataaggcaagatgggagccaacgtctgtcagaagcccagtgg
tatcctatctacaatgcagtgagaagagaagaaacagaaaatacagttggatctctactc
catttcctcaccaagctcccagcctccgagacagcccatggaaggataagcgttggtcca
tgcttaaagcaatgtgtccgagacactgtatgtgagtatcgcgccaccctccaaaggact
tcaatatcgcagtacatcaccggttctctcctagaagcaaccacgtctttgggagcaaga
agtggccttctcagtacttttggaggatccactggacgaatgatgctgaaagaacgccag
ccaggcccctctgtggccaattccaatgccctcccttcaagttcagctgggatcagcaag
gagctgatcgatctgcagcctctcatccagttcccagaggaagtcgccagcatcctgatg
gagcaagagcagactatttaccgcagggtcttgccagtcgactacctttgcttcttaaca
cgggacttgggcactcctgaatgccagagctccttgccctgcctcaaagcatccatctca
gcgtcgattcttaccactcagaatggagagcacaatgcccttgaagatctggtgatgagg
tttaatgaggtgagctcctgggtgacatggctgatcctcacggcaggctccatggaggag
aagcgagaagtcttttcatatttggtgcatgtggccaaatgctgctggaacatgggcaac
tacaacgctgtcatggagttcttggctggcctcaggtcaagaaaagttttaaaaatgtgg
cagttcatggaccagtctgatattgagaccatgaggagcctgaaggatgctatggcccag
catgagtcctcttgtgagtacagaaaggtggtgacacgtgccctgcacatccctggctgt
aaggtggttccattctgtggggtgtttctgaaggagctctgtgaagtgcttgacggcgcc
tccggtctcatgaagctttgcccgcggtacaattcccaagaagaaactttagagtttgta
gcagattacagtggacaagataatttcttacaacgagtgggacaaaatggcttaaagaat
tcggagaaggagtccactgtcaacagcatctttcaggtcatccggagctgcaatcgaagt
ctggagacagacgaggaggacagccccagtgaaggaaacagctccaggaaaagctccttg
aaggataaaagccgatggcagtttataattggagatttgttggattcagacaatgacatc
tttgagcaatccaaagaatacgactctcatggttcagaggactcacagaaggccttcgac
catgggacggagctcatcccttggtacgtgctgtccatccaagccgatgtgcaccagttc
ctgctgcagggggccacggtcatccactacgaccaggacacacacctctctgcccgctgc
ttcctccagcttcagcccgacaatagcaccttgacctgggtaaagcccacaactgcctcc
ccagccagcagtaaagcaaaacttggtgtacttaataacacagctgagcctggaaaattc
ccactactgggtaatgctggattaagtagcctgacggaaggggtcttggatctttttgca
gtgaaggctgtatacatgggccaccctggcattgatatacacactgtgtgtgttcagaac
aaactgggtagcatgttcctgtcagagactggtgtgacattgctctatgggcttcagacc
acagacaacagattattgcacttcgtggcaccaaagcacacagctaaaatgctcttcagc
ggattattggaactcactagagctgtgagaaagatgaggaaattccctgaccaaagacag
cagtggctgcggaaacagtacgtcagcctttatcaggaggatggacggtatgaaggccca
actttggctcacgctgtggagttgtttggtggcagacggtggagtgctcgaaaccccagc
cccggaacatcagcaaagaatgctgagaagcccaatatgcagagaaacaataccctgggc
ataagcactaccaagaaaaagaagaaaatcctcatgaggggtgagagtggagaggtaact
gacgatgagatggcaacccgaaaggccaagatgcacaaagagtgtcgaagccggagtggt
tctgatcctcaagacattaatgaacaagaagaatcagaggtgaatgccatcgctaaccct
ccaaaccccctcccttccagaagagcccactctttgaccacagctgggtcccccaacttg
gctgccgggacgtcatctcccatcaggccagtgtcctcccctgtgctgtcttcttcaaac
aagagcccatccagtgcttggagcagtagtagctggcacgggcggatcaaaggcggcatg
aagggatttcagagcttcatggtttcagatagcaacatgagttttgttgaatttgttgag
ctgttcaaatcattcagtgtcaggagccgcaaggacctgaaggatctgtttgatgtctat
gcagtgccctgcaaccgatctggctccgagtcagccccactctacaccaacctgacaatt
gatgaaaacaccagcgatcttcagcctgacctagatctgttgaccagaaatgtctcggat
ttggggttgttcattaagagtaaacagcagctatcggacaaccagaggcagatatctgat
gccattgctgctgcaagcattgtgacaaatggcactgggattgagagcacatctctgggc
atttttggggtgggcatacttcagctcaacgatttcctcgtgaattgccaaggagaacac
tgcacttatgatgaaatcctcagcatcatccagaagttcgagcctagcatcagtatgtgt
catcagggactaatgtcatttgaagggtttgccaggtttctgatggataaagaaaatttt
gcctcaaaaaatgatgagtcacaggagaacattaaagaactgcagctacccctctcatac
tattacatcgaatcttcgcacaatacctacctcacgggccatcagctcaaaggagaatcc
tcggtagaactctacagccaggtccttttgcaaggctgtcgaagtgtagaattggactgc
tgggacggagacgatgggatgcccatcatttatcatggacatacgctgacaaccaagatc
cccttcaaggaagtggttgaagccattgatcgcagtgccttcatcaactctgacctgcca
atcatcatatcgattgagaaccactgttcattgcctcagcaacgaaaaatggcagaaatt
ttcaagactgtgtttggagaaaagctggtgactaaattcttatttgagactgatttctca
gatgatccaatgcttccttcacctgaccaactcagaaagaaagttcttcttaaaaacaag
aagctaaaagcccatcagacgccagtggatatcttaaagcaaaaggctcatcagttagca
tctatgcaagtgcaggcttataatggtgggaatgccaacccccgacctgccaataatgag
gaagaggaagatgaggaggacgaatatgattatgactatgaatccctttctgatgacaac
attctggaagacagacctgaaaataaatcatgtaatgacaagcttcagtttgaatataat
gaagaaatcccaaagaggataaagaaagcagataactctgcttgcaacaaaggaaaggtt
tatgatatggaactgggagaagaattttatcttgatcagaataaaaaggaaagcagacag
attgcaccagagctttctgaccttgtaatctattgtcaagcagtaaaatttccaggactg
tcaactctaaatgcatctggctctagcagaggaaaagaaaggaaaagcaggaagtccatt
tttggcaacaatccgggcagaatgagcccaggggagacagcatcatttaacaaaacatct
ggaaaaagttcctgtgaaggcattcgacagacctgggaggaatcttcttcccctctcaac
ccaaccacgtccctcagtgctatcattagaactcccaaatgttatcatatctcgtcgctg
aatgaaaatgccgccaaacgtctgtgtcgcaggtattctcagaaactgacccagcacacc
gcctgtcagctgctgagaacttaccctgctgccacccgcatcgactcttccaacccgaac
cccctcatgttctggctccatgggatacagcttgtggcactcaactaccagactgatgat
ctccctttacatttaaatgctgcaatgtttgaggcaaatggtggttgtggttatgtattg
aaacctccagttctgtgggacaagaactgccccatgtatcagaagttttctccactagaa
agagatctggacagcatggatcctgcagtctattctttaactattgtctctggtcagaat
gtgtgccccagtaatagcatgggaagcccgtgcattgaagtcgacgtcctgggcatgcct
ctggacagctgccatttccgcacaaagcccatccatcgaaacaccctgaaccccatgtgg
aacgagcagtttctgttccacgttcacttcgaagatcttgtatttcttcgttttgcagtt
gtggaaaacaatagttcagcggtaactgctcagagaatcattccactgaaagctttaaaa
cgaggatatcgacatcttcagctgcgaaaccttcacaatgaagtcttggagatttctagt
ttattcattaacagcagaaggatggaagaaaattcctctggcaataccatgtcagcctct
tcgatgtttaatacagaagaaagaaaatgtttgcagactcacagagtcacggtgcatggg
gtcccagggccagagccctttaccgttttcactattaatggaggcaccaaggcaaagcag
cttctgcagcaaattctgacaaatgaacaagacatcaaacctgttaccacagactatttt
ttgatggaagaaaaatattttatatctaaagaaaagaatgaatgtaggaaacaaccattc
cagagagccattggtccagaagaggagatcatgcaaattttaagcagctggtttccagaa
gagggatacatgggcaggattgtcttaaaaacccagcaggaaaacctagaagagaaaaac
attgttcaagatgacaaagaggtgatcttgagctcagaggaggagagtttctttgtccaa
gtgcatgatgtttctccagagcaacctcgaacagtcatcaaagcaccccgcgtcagcact
gcacaggatgtcattcagcagaccttatgcaaagccaaatattcctacagcatcctgagc
aaccccaatccaagcgactatgtgcttttggaagaggtggtgaaagacactaccaacaag
aagactaccacaccaaagtcctctcagcgggtccttctggatcaggagtgtgtgtttcaa
gcccaaagcaagtggaaaggtgcaggaaaattcatccttaagctaaaggagcaggtgcag
gcatctcgagaagataaaaagaaaggcatttctttcgcaagtgaactcaagaagctcacc
aagtcaactaaacagccccgaggacttacatcaccttctcagctcttgacctcagaaagt
atccaaaccaaggaggagaaacctgtgggtggcttgtcctccagtgacacaatggattac
cgacagtga

KEGG   Homo sapiens (human): 5330Help
Entry
5330              CDS       T01001                                 

Gene name
PLCB2, PLC-beta-2
Definition
(RefSeq) phospholipase C beta 2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04062  Chemokine signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04310  Wnt signaling pathway
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04621  NOD-like receptor signaling pathway
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04742  Taste transduction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04934  Cushing syndrome
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa04973  Carbohydrate digestion and absorption
hsa05010  Alzheimer disease
hsa05016  Huntington disease
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05146  Amoebiasis
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Network
nt06124  Chemokine signaling (virus)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06316  Angiotensin-aldosterone signaling
nt06318  CaSR-PTH signaling
  Element
N00291  CaSR-PTH signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
N00407  HCMV UL33 to GNAQ-PLCB/G-calcineurin signaling pathway
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
N00428  CCR5-GNB/G-PLCB/G-PKC signaling pathway
N00546  CXCL12-CXCR4-PKC-ERK signaling pathaway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5330 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    5330 (PLCB2)
   04310 Wnt signaling pathway
    5330 (PLCB2)
   04371 Apelin signaling pathway
    5330 (PLCB2)
   04020 Calcium signaling pathway
    5330 (PLCB2)
   04070 Phosphatidylinositol signaling system
    5330 (PLCB2)
   04072 Phospholipase D signaling pathway
    5330 (PLCB2)
   04071 Sphingolipid signaling pathway
    5330 (PLCB2)
   04022 cGMP-PKG signaling pathway
    5330 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    5330 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5330 (PLCB2)
   04621 NOD-like receptor signaling pathway
    5330 (PLCB2)
   04062 Chemokine signaling pathway
    5330 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    5330 (PLCB2)
   04922 Glucagon signaling pathway
    5330 (PLCB2)
   04912 GnRH signaling pathway
    5330 (PLCB2)
   04915 Estrogen signaling pathway
    5330 (PLCB2)
   04921 Oxytocin signaling pathway
    5330 (PLCB2)
   04926 Relaxin signaling pathway
    5330 (PLCB2)
   04918 Thyroid hormone synthesis
    5330 (PLCB2)
   04919 Thyroid hormone signaling pathway
    5330 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    5330 (PLCB2)
   04916 Melanogenesis
    5330 (PLCB2)
   04924 Renin secretion
    5330 (PLCB2)
   04925 Aldosterone synthesis and secretion
    5330 (PLCB2)
   04927 Cortisol synthesis and secretion
    5330 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5330 (PLCB2)
   04270 Vascular smooth muscle contraction
    5330 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    5330 (PLCB2)
   04971 Gastric acid secretion
    5330 (PLCB2)
   04972 Pancreatic secretion
    5330 (PLCB2)
   04973 Carbohydrate digestion and absorption
    5330 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    5330 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    5330 (PLCB2)
   04725 Cholinergic synapse
    5330 (PLCB2)
   04728 Dopaminergic synapse
    5330 (PLCB2)
   04726 Serotonergic synapse
    5330 (PLCB2)
   04720 Long-term potentiation
    5330 (PLCB2)
   04730 Long-term depression
    5330 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    5330 (PLCB2)
  09157 Sensory system
   04742 Taste transduction
    5330 (PLCB2)
   04750 Inflammatory mediator regulation of TRP channels
    5330 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    5330 (PLCB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5330 (PLCB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5330 (PLCB2)
   05016 Huntington disease
    5330 (PLCB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    5330 (PLCB2)
   04934 Cushing syndrome
    5330 (PLCB2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    5330 (PLCB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5330 (PLCB2)
   05142 Chagas disease (American trypanosomiasis)
    5330 (PLCB2)
   05143 African trypanosomiasis
    5330 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5330 (PLCB2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     5330 (PLCB2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    5330 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    5330 (PLCB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 Gp58
Motif
Other DBs
NCBI-GeneID: 5330
NCBI-ProteinID: NP_004564
OMIM: 604114
HGNC: 9055
Ensembl: ENSG00000137841
Vega: OTTHUMG00000172412
Pharos: Q00722(Tbio)
UniProt: Q00722 Q59F77
LinkDB All DBs
Structure
PDB: 

Position
15q15.1
AA seq 1185 aa AA seqDB search
MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKAWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPEPVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINAQRGQLSPEGMVWFLCGPEN
SVLAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPIILSFENHVDSPRQQAKM
AEYCRTIFGDMLLTEPLEKFPLKPGVPLPSPEDLRGKILIKNKKNQFSGPTSSSKDTGGE
AEGSSPPSAPAGEGTVWAGEEGTELEEEEVEEEEEEESGNLDEEEIKKMQSDEGTAGLEV
TAYEEMSSLVNYIQPTKFVSFEFSAQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQM
SRIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMAVFEFNGQSGYLLKHEF
MRRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRT
KLSPSTNSINPVWKEEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINALNSGYHHL
CLHSESNMPLTMPALFIFLEMKDYIPGAWADLTVALANPIKFFSAHDTKSVKLKEAMGGL
PEKPFPLASPVASQVNGALAPTSNGSPAARAGAREEAMKEAAEPRTASLEELRELKGVVK
LQRRHEKELRELERRGARRWEELLQRGAAQLAELGPPGVGGVGACKLGPGKGSRKKRSLP
REESAGAAPGEGPEGVDGRVRELKDRLELELLRQGEEQYECVLKRKEQHVAEQISKMMEL
AREKQAAELKALKETSENDTKEMKKKLETKRLERIQGMTKVTTDKMAQERLKREINNSHI
QEVVQVIKQMTENLERHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAEVKE
SVRACLRTCFPSEAKDKPERACECPPELCEQDPLIAKADAQESRL
NT seq 3558 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgctcaaccctgtcctgctgccccccaaggtgaaggcctatctgagccaaggg
gagcgcttcatcaaatgggatgatgaaactacagttgcctctccagttatcctccgtgtg
gatcctaagggctactacttatactggacgtatcaaagtaaggagatggagtttctggat
atcaccagcatccgggatactcgctttgggaagtttgccaagatgcccaagagccagaag
ctccgggacgtcttcaacatggactttcctgataacagtttcctgctgaagacactcacg
gtggtgtccggcccggacatggtggacctcaccttccacaacttcgtctcctacaaggag
aacgtgggcaaggcctgggctgaggacgtactggccctagtcaaacatccgctgacggcc
aacgcctcccgcagcaccttcctggacaagatccttgtgaagctcaagatgcagctcaac
tctgaagggaagattccggtgaagaactttttccagatgtttcctgctgaccgcaagcgg
gtggaagctgctctcagtgcctgccacctccccaaaggcaaaaatgacgccatcaatcct
gaggacttcccagaacctgtctacaagagtttcctcatgagcctctgtcctcggccagaa
atagatgagatcttcacttcttaccatgctaaggccaaaccctacatgacgaaggagcac
ctgaccaaattcatcaaccagaaacagcgggactcccggcttaactccctgctgttcccg
ccagcacggcctgaccaggtgcagggcctcatcgacaagtatgagcccagtggcatcaat
gcacagaggggccagctgtcacctgaaggcatggtctggtttctctgtgggccagagaac
agcgtgctggcccaggacaagctgctgctccaccacgacatgacgcagccactcaatcat
tacttcatcaactcgtcccacaacacctacctgacagccggccagttctcaggcctctcc
tcggctgagatgtaccgccaggtgctgctctctggctgccgttgcgtggagctagactgc
tggaaggggaaaccccctgacgaggagcccattatcacccatggcttcaccatgaccaca
gacatcttcttcaaagaagcaattgaggctattgcagaaagcgcctttaagacctccccc
tatcccatcatcctgtcgtttgagaaccatgtggactcaccccgccagcaggctaagatg
gctgagtattgccggacgatctttggggatatgctgctcacagagcccctggaaaagttc
ccactaaaaccaggtgtccccctgcccagccctgaggatctcaggggcaagatcctcatc
aagaacaagaagaaccagttttctggccccacctcctccagtaaggatactggtggggag
gctgagggcagcagcccacccagtgcccctgcaggtgagggcacagtgtgggctggcgag
gaagggactgagctggaggaggaggaggtggaagaggaagaggaggaggagtcaggaaac
ctggatgaagaagagattaagaagatgcagtcggatgagggcacagcgggcctggaagtg
acggcttatgaggagatgtccagcctagtcaattacatccagcccaccaagttcgtctcc
tttgagttctctgcccaaaagaaccgaagttatgtcatctcgtccttcacagagctcaag
gcatatgacctgctctccaaggcctcggtgcagtttgtggactacaacaagcgccagatg
agccgcatttaccccaagggaacccgcatggactcctccaactacatgccccagatgttc
tggaatgctggatgccagatggttgccctcaacttccagacgatggacttgcccatgcag
cagaacatggcagtatttgagttcaacgggcagagcggctacctcctcaagcatgagttc
atgcgccggccggacaagcagttcaaccccttctcagtggaccgcatcgacgtggtggtg
gccaccaccctttccattacggtgatctctgggcagttcctgtcagaacgcagcgtgcgc
acctatgtagaagtggagctgtttggccttcctggggaccccaagaggcgctatcgaact
aagctgtcacccagtactaactccatcaatcctgtctggaaggaggagccctttgtcttt
gagaagatcttgatgcctgagctggcctccctcagagtggctgtgatggaggaaggcaac
aagtttcttggacaccgcatcatccccatcaatgccctaaattctgggtaccaccacctg
tgcctgcacagtgagagcaacatgcccctcaccatgcctgcgctcttcatcttcctggag
atgaaggactacatacctggtgcttgggcagatctcactgtggccctcgccaaccccatt
aagttcttcagtgcccatgacacgaagtctgtgaagctcaaggaggccatgggaggtctg
cctgagaagcccttcccactggcgagtccagttgccagccaggtcaatggggcgttggcc
ccaacgagcaatgggtcaccagcagccagggccggggccagggaagaggctatgaaagaa
gctgcggagccgcggaccgccagcctggaggagctccgggagctaaagggcgtggtgaag
ctgcagcggcggcacgagaaggagctgcgagagttggagcggcgcggagcgcggcgctgg
gaggagctgctgcagcggggcgcggcgcagctggcggagctcgggccaccgggcgtgggg
ggcgtcggggcctgcaagctcggtcccggcaagggctctcgcaagaagaggagcctgccc
cgcgaggagagcgccggagccgcgccgggcgagggccctgagggcgtggacgggcgcgtg
cgggagctgaaagacaggctggagctggagctgctgcggcagggcgaggagcagtacgag
tgcgttctgaagcgcaaggagcagcacgtggccgagcaaatctccaaaatgatggagctg
gccagagagaaacaggcggcagagctgaaggccctgaaggagacgtcggagaacgacacc
aaagagatgaagaaaaagctggagacaaagagactggagcggatccagggcatgaccaaa
gtcaccacagacaagatggcccaggagaggttgaagagagagattaacaactcccacatc
caggaagtagtgcaggtgatcaagcagatgacggagaacttggagaggcaccaggagaag
ctggaggagaagcaggcggcttgcctggaacagatacgggagatggaaaagcagttccag
aaggaggcgctggcagagtacgaggccaggatgaagggtctggaggcagaggtgaaggag
tcggtgagggcctgcctcaggacctgctttccctccgaggccaaggacaagcctgagagg
gcctgcgagtgccccccagagctgtgtgagcaggacccactcatagcaaaggcagatgcc
caggagagccgcctctga

KEGG   Homo sapiens (human): 5331Help
Entry
5331              CDS       T01001                                 

Gene name
PLCB3
Definition
(RefSeq) phospholipase C beta 3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04062  Chemokine signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04310  Wnt signaling pathway
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04621  NOD-like receptor signaling pathway
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04934  Cushing syndrome
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa05010  Alzheimer disease
hsa05016  Huntington disease
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05146  Amoebiasis
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Network
nt06124  Chemokine signaling (virus)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06316  Angiotensin-aldosterone signaling
nt06318  CaSR-PTH signaling
  Element
N00291  CaSR-PTH signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
N00407  HCMV UL33 to GNAQ-PLCB/G-calcineurin signaling pathway
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
N00428  CCR5-GNB/G-PLCB/G-PKC signaling pathway
N00546  CXCL12-CXCR4-PKC-ERK signaling pathaway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5331 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    5331 (PLCB3)
   04310 Wnt signaling pathway
    5331 (PLCB3)
   04371 Apelin signaling pathway
    5331 (PLCB3)
   04020 Calcium signaling pathway
    5331 (PLCB3)
   04070 Phosphatidylinositol signaling system
    5331 (PLCB3)
   04072 Phospholipase D signaling pathway
    5331 (PLCB3)
   04071 Sphingolipid signaling pathway
    5331 (PLCB3)
   04022 cGMP-PKG signaling pathway
    5331 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    5331 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5331 (PLCB3)
   04621 NOD-like receptor signaling pathway
    5331 (PLCB3)
   04062 Chemokine signaling pathway
    5331 (PLCB3)
  09152 Endocrine system
   04911 Insulin secretion
    5331 (PLCB3)
   04922 Glucagon signaling pathway
    5331 (PLCB3)
   04912 GnRH signaling pathway
    5331 (PLCB3)
   04915 Estrogen signaling pathway
    5331 (PLCB3)
   04921 Oxytocin signaling pathway
    5331 (PLCB3)
   04926 Relaxin signaling pathway
    5331 (PLCB3)
   04918 Thyroid hormone synthesis
    5331 (PLCB3)
   04919 Thyroid hormone signaling pathway
    5331 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    5331 (PLCB3)
   04916 Melanogenesis
    5331 (PLCB3)
   04924 Renin secretion
    5331 (PLCB3)
   04925 Aldosterone synthesis and secretion
    5331 (PLCB3)
   04927 Cortisol synthesis and secretion
    5331 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5331 (PLCB3)
   04270 Vascular smooth muscle contraction
    5331 (PLCB3)
  09154 Digestive system
   04970 Salivary secretion
    5331 (PLCB3)
   04971 Gastric acid secretion
    5331 (PLCB3)
   04972 Pancreatic secretion
    5331 (PLCB3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    5331 (PLCB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    5331 (PLCB3)
   04725 Cholinergic synapse
    5331 (PLCB3)
   04728 Dopaminergic synapse
    5331 (PLCB3)
   04726 Serotonergic synapse
    5331 (PLCB3)
   04720 Long-term potentiation
    5331 (PLCB3)
   04730 Long-term depression
    5331 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    5331 (PLCB3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5331 (PLCB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    5331 (PLCB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5331 (PLCB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5331 (PLCB3)
   05016 Huntington disease
    5331 (PLCB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    5331 (PLCB3)
   04934 Cushing syndrome
    5331 (PLCB3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    5331 (PLCB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5331 (PLCB3)
   05142 Chagas disease (American trypanosomiasis)
    5331 (PLCB3)
   05143 African trypanosomiasis
    5331 (PLCB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5331 (PLCB3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     5331 (PLCB3)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    5331 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    5331 (PLCB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 BPL_N
Motif
Other DBs
NCBI-GeneID: 5331
NCBI-ProteinID: NP_000923
OMIM: 600230
HGNC: 9056
Ensembl: ENSG00000149782
Vega: OTTHUMG00000167816
Pharos: Q01970(Tbio)
UniProt: Q01970
LinkDB All DBs
Structure
PDB: 

Position
11q13.1
AA seq 1234 aa AA seqDB search
MAGAQPGVHALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVSGPDPVNTVFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLKFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSTDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIEPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPSAGGPDS
AGRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPQKSLGD
EGLNRGPYVLGPADREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRARQLAALIGESEAQAGQETCQDTQSQQL
GSQPSSNPTPSPLDASPRRPPGPTTSPASTSLSSPGQRDDLIASILSEVAPTPLDELRGH
KALVKLRSRQERDLRELRKKHQRKAVTLTRRLLDGLAQAQAEGRCRLRPGALGGAADVED
TKEGEDEAKRYQEFQNRQVQSLLELREAQVDAEAQRRLEHLRQALQRLREVVLDANTTQF
KRLKEMNEREKKELQKILDRKRHNSISEAKMRDKHKKEAELTEINRRHITESVNSIRRLE
EAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGEMPEGLG
DGPLVACASNGHAPGSSGHLSGADSESQEENTQL
NT seq 3705 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgcccagcccggcgtccacgcgctgcagttggagccgcccaccgtggtggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggagacctccagtcggaacctg
gtgaccctgcgtgtggaccccaatggcttcttcttgtactggacgggccccaacatggag
gtggacacactggacatcagttccatcagggacacacggacaggccggtacgcccgcctg
cccaaggaccccaagatccgggaagttctgggctttgggggtcccgatgcccggctggag
gagaagctgatgacggtggtgtctgggccagacccagtgaacacagtgttcttgaacttc
atggccgtgcaggatgacacagccaaggtctggtctgaggagctattcaagctggctatg
aacatcctggctcagaacgcctcccggaacaccttcctgcgcaaagcatacacgaagctg
aagctgcaggtgaaccaggatggtcggatccccgtcaagaacatcctgaagatgttctca
gcagacaagaagcgggtggagactgcgctggaatcctgtggcctcaaattcaaccggagt
gagtccatccggcctgatgagttttccttggaaatctttgagcggttcctgaacaagctg
tgtctgcggccggacattgacaagatcctgctggagataggcgccaagggcaagccatac
ctgacgctggagcagctcatggacttcatcaaccagaagcaacgcgacccgagactcaac
gaagtgctgtacccgcccctgcggccctcccaggcccggctgctcatcgaaaagtatgag
cccaaccagcagtttctggagcgagaccagatgtccatggagggctttagccgctacctg
ggaggcgaggagaatggcatcctgcccctggaagccctggatctgagcacggacatgacc
cagccactgagtgcctacttcatcaactcctcgcataacacctatctcactgcggggcag
ctggctgggacctcgtcggtggagatgtaccgccaggcactactatggggctgccgctgc
gtggagctggacgtgtggaagggacggccgcctgaggaggaacccttcattacccacggc
ttcaccatgaccacagaggtgcctctgcgcgacgtgctggaggccattgccgagactgcc
ttcaagacctcgccctaccccgtcatcctctccttcgagaaccatgtggactcggcaaag
caacaggcaaagatggctgagtactgccgctccatctttggagacgcgctactcatcgag
cctctggacaagtacccgctggccccaggcgttcccctgcccagcccccaggacctgatg
ggccgtatcctggtgaagaacaagaagcggcaccgacccagcgcaggtggcccagacagc
gccgggcgcaagcggcccctggagcagagcaattctgccctgagcgagagctccgcggcc
accgagccctcctccccgcagctggggtctcccagctctgacagctgcccaggcctgagc
aatggggaggaggtagggcttgagaagcccagcctggagcctcagaagtctctgggtgac
gagggcctgaaccgaggcccctatgttcttggacctgctgaccgtgaggatgaggaggaa
gatgaggaagaggaggaacagacagaccccaaaaagccaactacagatgagggcacagcc
agcagcgaggtgaatgccactgaggagatgtccacgcttgtcaactacatcgaacctgtc
aagttcaagtcctttgaggctgctcgaaagaggaacaaatgcttcgagatgtcgtccttt
gtggagaccaaggccatggagcaactgaccaagagccccatggagtttgtggaatacaac
aagcagcagctcagccgcatctaccccaagggcacccgcgtggactcctccaactacatg
ccccagctcttctggaacgtagggtgccagcttgttgcgctcaacttccagaccctcgat
gtggcgatgcagctcaacgcgggcgtttttgagtacaacgggcgcagcgggtacctgctc
aagccggagttcatgcggcggccggacaagtccttcgaccccttcactgaggtcatcgtg
gatggcatcgtggccaatgccttgcgggtcaaggtgatctcagggcagttcctgtccgac
aggaaggtgggcatctacgtggaggtggacatgtttggcctccctgttgatacgcggcgc
aagtaccgcacccggacctctcaggggaactcgttcaaccccgtgtgggacgaagagccc
ttcgacttccccaaggtggtgctgcccacgctggcttcacttcgcattgcagcctttgag
gaggggggtaaattcgtagggcaccggatcctgcctgtctctgccatccgctccggatac
cactacgtctgcctgcggaacgaggccaaccaaccgctgtgcctgccggccctgctcatc
tacaccgaagcctcggactacattcctgacgaccaccaggactatgcggaggccctgatc
aaccccattaagcacgtcagcctgatggaccagagggcccggcagctggccgccctcatt
ggggagagtgaggctcaggctggccaagagacgtgccaggacacccagtctcagcagctg
gggtctcagccgtcctcaaaccccacccccagcccactggatgcctccccccgccggccc
cctggccccaccacctcccctgccagcacctccctcagcagcccagggcagcgtgatgat
ctcatcgccagcatcctctcagaggtggcccccaccccgctggatgagctccgaggtcac
aaggctctggtcaagctccggagccggcaagagcgagacctgcgggagctgcgcaagaag
catcagcggaaggcagtcaccctcacccgccgcctgctggatggcctggctcaggcacag
gctgagggcaggtgccggctgcggccaggtgccctaggtggggccgctgatgtggaggac
acgaaggagggggaggacgaggcaaagcggtatcaggagttccagaacagacaggtgcag
agcctgctggagctgcgggaggcccaggtggacgcagaggcccagcggaggctggaacac
ctgagacaggctctgcagcggctcagggaggtcgtccttgatgcaaacacaactcagttc
aagaggctgaaagagatgaacgagagggagaagaaggagctgcagaagatcctggacaga
aagcgccataacagcatctcggaggccaagatgagggacaagcataagaaggaggcggaa
ctgacggagattaaccgtcggcacatcactgagtcagtcaactccatccgtcggctggag
gaggcccagaagcagcggcatgaccgtcttgtggctgggcagcagcaggtcctgcaacag
ctggcagaagaggagcccaagctgctggcccagctggcccaggagtgtcaggagcagcgg
gcgaggctcccccaggagatccgccggagcctgctgggcgagatgccggaggggctgggg
gacgggcctctggtggcctgtgccagcaacggtcacgcacccgggagcagcgggcacctg
tcgggcgctgactcggagagccaggaggagaacacgcagctctga

KEGG   Homo sapiens (human): 5332Help
Entry
5332              CDS       T01001                                 

Gene name
PLCB4, ARCND2, PI-PLC
Definition
(RefSeq) phospholipase C beta 4
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04062  Chemokine signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04310  Wnt signaling pathway
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04621  NOD-like receptor signaling pathway
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04934  Cushing syndrome
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa05010  Alzheimer disease
hsa05016  Huntington disease
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05146  Amoebiasis
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Network
nt06124  Chemokine signaling (virus)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06316  Angiotensin-aldosterone signaling
nt06318  CaSR-PTH signaling
  Element
N00291  CaSR-PTH signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
N00407  HCMV UL33 to GNAQ-PLCB/G-calcineurin signaling pathway
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
N00428  CCR5-GNB/G-PLCB/G-PKC signaling pathway
N00546  CXCL12-CXCR4-PKC-ERK signaling pathaway
Disease
H01884  Auriculocondylar syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5332 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    5332 (PLCB4)
   04310 Wnt signaling pathway
    5332 (PLCB4)
   04371 Apelin signaling pathway
    5332 (PLCB4)
   04020 Calcium signaling pathway
    5332 (PLCB4)
   04070 Phosphatidylinositol signaling system
    5332 (PLCB4)
   04072 Phospholipase D signaling pathway
    5332 (PLCB4)
   04071 Sphingolipid signaling pathway
    5332 (PLCB4)
   04022 cGMP-PKG signaling pathway
    5332 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    5332 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5332 (PLCB4)
   04621 NOD-like receptor signaling pathway
    5332 (PLCB4)
   04062 Chemokine signaling pathway
    5332 (PLCB4)
  09152 Endocrine system
   04911 Insulin secretion
    5332 (PLCB4)
   04922 Glucagon signaling pathway
    5332 (PLCB4)
   04912 GnRH signaling pathway
    5332 (PLCB4)
   04915 Estrogen signaling pathway
    5332 (PLCB4)
   04921 Oxytocin signaling pathway
    5332 (PLCB4)
   04926 Relaxin signaling pathway
    5332 (PLCB4)
   04918 Thyroid hormone synthesis
    5332 (PLCB4)
   04919 Thyroid hormone signaling pathway
    5332 (PLCB4)
   04928 Parathyroid hormone synthesis, secretion and action
    5332 (PLCB4)
   04916 Melanogenesis
    5332 (PLCB4)
   04924 Renin secretion
    5332 (PLCB4)
   04925 Aldosterone synthesis and secretion
    5332 (PLCB4)
   04927 Cortisol synthesis and secretion
    5332 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5332 (PLCB4)
   04270 Vascular smooth muscle contraction
    5332 (PLCB4)
  09154 Digestive system
   04970 Salivary secretion
    5332 (PLCB4)
   04971 Gastric acid secretion
    5332 (PLCB4)
   04972 Pancreatic secretion
    5332 (PLCB4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    5332 (PLCB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    5332 (PLCB4)
   04725 Cholinergic synapse
    5332 (PLCB4)
   04728 Dopaminergic synapse
    5332 (PLCB4)
   04726 Serotonergic synapse
    5332 (PLCB4)
   04720 Long-term potentiation
    5332 (PLCB4)
   04730 Long-term depression
    5332 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    5332 (PLCB4)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5332 (PLCB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    5332 (PLCB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5332 (PLCB4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5332 (PLCB4)
   05016 Huntington disease
    5332 (PLCB4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    5332 (PLCB4)
   04934 Cushing syndrome
    5332 (PLCB4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    5332 (PLCB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5332 (PLCB4)
   05142 Chagas disease (American trypanosomiasis)
    5332 (PLCB4)
   05143 African trypanosomiasis
    5332 (PLCB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5332 (PLCB4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     5332 (PLCB4)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    5332 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    5332 (PLCB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_7 EF-hand_6
Motif
Other DBs
NCBI-GeneID: 5332
NCBI-ProteinID: NP_877949
OMIM: 600810
HGNC: 9059
Ensembl: ENSG00000101333
Vega: OTTHUMG00000031853
Pharos: Q15147(Tbio)
UniProt: Q15147
LinkDB All DBs
Position
20p12.3-p12.2
AA seq 1175 aa AA seqDB search
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVL
ECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPTAFSYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRLKPEVEKKQLEALRSM
MEAGESASPANILEDDNEEEIESADQEEEAHPEFKFGNELSADDLGHKEAVANSVKKGLV
TVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVG
LGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQL
NQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGT
YVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNK
LIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKK
FLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQSSSELRPTTTAA
LASGVEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQ
VDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQH
TKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLSHDRESKEMRAHQ
AKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQ
LEHLEFLEKQNEQAKEMQQMVKLEAEMDRRPATVV
NT seq 3528 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaccttatgaatttaactggcagaaggaagttccctcctttttgcaagaagga
gcagtttttgacagatacgaggaggaatcctttgtgtttgaacccaactgcctcttcaaa
gtggatgagtttggcttctttctgacatggagaagtgaaggcaaggaaggacaggtgcta
gaatgctccctcatcaacagtattcggtcgggagccataccaaaggatcccaaaatcttg
gctgctcttgaagctgttggaaaatcagaaaatgatctggaagggcggatagtttgtgtc
tgcagtggcacagatctagtgaacattagttttacctacatggtggctgaaaatccagaa
gtaactaagcaatgggtagaaggcctgagatcaatcatacacaacttcagggccaacaac
gtcagtccaatgacatgcctcaagaaacactggatgaaattggcatttatgaccaacaca
aatggtaaaattccagttaggagtattactagaacatttgcatcgggaaaaacagaaaag
gtgatctttcaagcactcaaggagttaggtcttcccagtggaaagaatgatgaaattgag
cccacagcattttcttatgaaaagttctatgaactgacacaaaagatttgtcctcggaca
gatatagaagatcttttcaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcaacgagatcctcgattgaatgaaattttattt
ccattttatgatgccaaaagggcaatgcagatcattgagatgtatgaacctgatgaagat
ttgaagaaaaaaggccttatatcaagtgatgggttttgcagatatctgatgtcagatgaa
aacgccccagtcttcctagatcgtttagaactttaccaagaaatggaccatcctctggct
cactacttcatcagttcttcccataacacttatctcactggcagacagttcggcgggaag
tcttcggtagaaatgtacagacaggttctcctggctggttgcagatgtgttgaacttgac
tgctgggatggaaaaggtgaagaccaagaaccaataataactcatggaaaagcaatgtgt
acagatatcctttttaaggatgtaattcaagccatcaaggaaactgcatttgtcacatca
gaatatcctgtaattctctcctttgaaaatcactgcagcaaatatcaacagtacaagatg
tccaaatattgcgaagatctatttggggatctcctgttgaaacaagcacttgaatcacat
ccacttgaaccaggcagggctttgccatcccccaatgacctcaaaagaaaaatactcata
aaaaacaagcggctgaaacctgaagttgaaaaaaaacagctggaagctttgagaagcatg
atggaagctggagaatctgcctccccagcaaacatcttagaggacgataatgaagaggag
atcgaaagtgctgaccaagaggaggaagctcaccccgaattcaaatttggaaatgaactt
tctgctgatgacttgggtcacaaggaagctgttgcaaatagcgtcaagaagggcctggtc
actgtagaagatgagcaggcgtggatggcatcttataaatatgtaggtgctaccactaat
atccatccatatttgtccacaatgatcaactacgcccagcctgtaaagtttcaaggtttc
catgtggcagaagaacgcaatattcattataacatgtcttcttttaatgaatcagtcggt
cttggctacttgaagacacatgcaattgaatttgtcaattataacaaacggcaaatgagt
cgcatttaccccaagggaggccgagtcgattccagtaattacatgcctcagattttctgg
aacgctggctgccagatggtttcactgaactatcaaaccccagatttagcgatgcaattg
aatcagggaaaatttgagtataatggatcgtgcgggtaccttctcaaaccagatttcatg
aggcggcctgatcgaacatttgaccccttctctgaaactcctgttgatggtgttattgca
gccacttgctcagtgcaggttatatcaggtcaattcttatcagataagaaaattggcacc
tacgtagaggtggatatgtatgggttgcccactgacaccatacgtaaggaattccgaact
cgcatggttatgaataatggactcaatccagtttacaatgaagagtcatttgtatttcgg
aaggtgatcctgccggacctggctgtcttgagaatagctgtgtatgatgataacaacaag
ctgattggccagaggatcctcccgcttgatggcctccaagccggatatcgacacatttcc
cttcgaaatgagggaaataaaccattatcactaccaacaattttctgcaatattgttctt
aaaacatatgtgcctgatggatttggagatatcgtggatgctttatcagatccaaagaaa
tttctctcaattacagaaaagagagcagaccaaatgagagctatgggcattgaaactagt
gacatagccgacgtgcccagtgacacttccaaaaatgacaagaaaggaaaggccaacacc
gccaaagcaaatgtgacccctcagagtagctctgagctcagaccaaccaccacggctgcc
ctggcctctggtgtggaagccaagaaaggtattgaacttatccctcaagtaaggatagaa
gacttaaagcagatgaaggcttacttgaagcatttaaagaaacagcagaaggagctaaat
tctttaaagaagaaacatgcaaaggaacacagtaccatgcagaagttacactgcacgcaa
gttgacaaaattgtggcacagtatgacaaagagaagtcgactcatgagaaaatcctagag
aaggcaatgaagaagaaggggggaagtaattgtctcgaaatgaaaaaagaaacagaaatc
aaaattcagacgctgacatcagatcacaaatctaaggtcaaagagattgtagcacagcac
acaaaggaatggtcagaaatgatcaatacccacagtgctgaggagcaagaaatccgagac
ctgcacctcagccagcagtgtgagctgctgaaaaagctactcatcaatgcccacgagcag
caaacccagcagctgaaactgtcccatgacagggaaagcaaggaaatgcgagcacaccag
gctaagatttctatggaaaatagcaaagccatcagccaagataaatctatcaagaataaa
gcagaacgggaaaggcgagtcagggagttaaacagcagcaacactaaaaagtttctggaa
gaaagaaagagacttgccatgaagcagtccaaagaaatggatcagttgaaaaaagtccag
cttgaacatctagaattcctagagaaacagaatgagcaggcgaaggagatgcagcagatg
gtgaaattggaagccgagatggaccgcagaccagcaacagtagtatga

KEGG   Homo sapiens (human): 5333Help
Entry
5333              CDS       T01001                                 

Gene name
PLCD1, NDNC3, PLC-III
Definition
(RefSeq) phospholipase C delta 1
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04919  Thyroid hormone signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Disease
H01307  Nonsyndromic congenital nail disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5333 (PLCD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    5333 (PLCD1)
   04070 Phosphatidylinositol signaling system
    5333 (PLCD1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    5333 (PLCD1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    5333 (PLCD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5333 (PLCD1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     5333 (PLCD1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    5333 (PLCD1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    5333 (PLCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 PH_12 PH EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5 TEP1_N
Motif
Other DBs
NCBI-GeneID: 5333
NCBI-ProteinID: NP_006216
OMIM: 602142
HGNC: 9060
Ensembl: ENSG00000187091
Vega: OTTHUMG00000130813
Pharos: P51178(Tchem)
UniProt: P51178 A0A384MR47 A8K8F9
LinkDB All DBs
Position
3p22.2
AA seq 756 aa AA seqDB search
MDSGRDFLTLHGLQDDEDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMR
TPESQLFSIEDIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH
WVLGLHKIIHHSGSMDQRQKLQHWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSY
ARKIFRECDHSQTDSLEDEEIEAFYKMLTQRVEIDRTFAEAAGSGETLSVDQLVTFLQHQ
QREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFSLAHRRVYQDMGQ
PLSHYLVSSSHNTYLLEDQLAGPSSTEAYIRALCKGCRCLELDCWDGPNQEPIIYHGYTF
TSKILFCDVLRAIRDYAFKASPYPVILSLENHCTLEQQRVMARHLHAILGPMLLNRPLDG
VTNSLPSPEQLKGKILLKGKKLGGLLPPGGEGGPEATVVSDEDEAAEMEDEAVRSRVQHK
PKEDKLRLAQELSDMVIYCKSVHFGGFSSPGTPGQAFYEMASFSENRALRLLQESGNGFV
RHNVGHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYQGRFQDNGACG
YVLKPAFLRDPNGTFNPRALAQGPWWARKRLNIRVISGQQLPKVNKNKNSIVDPKVTVEI
HGVSRDVASRQTAVITNNGFNPWWDTEFAFEVVVPDLALIRFLVEDYDASSKNDFIGQST
IPLNSLKQGYRHVHLMSKNGDQHPSATLFVKISLQD
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggactcgggccgggacttcctgaccctgcacggcctacaggatgatgaggatctacag
gcgctgctgaagggcagccagctcctgaaggtgaagtccagctcatggaggagagagcgc
ttctacaagttgcaggaggactgcaagaccatctggcaggagtcccgcaaggtcatgcgg
accccggagtcccagctgttctccatcgaggacattcaggaggtgcgaatggggcaccgc
acggagggtctggagaagttcgcccgtgatgtgcccgaggaccgctgcttctccattgtc
ttcaaggaccagcgcaatacactagacctcatcgccccatcgccagctgatgcccagcac
tgggtgctggggctgcacaagatcatccaccactcaggctccatggaccagcgtcagaag
ctacagcactggattcactcctgcttgcgaaaagctgacaaaaacaaggacaacaagatg
agcttcaaggagctgcagaacttcctgaaggagctcaacatccaggtggacgacagctat
gcccggaagatcttcagggagtgtgaccactcccagacagactccctggaggacgaggag
attgaggccttctacaagatgctgacccagcgggtggagatcgaccgcaccttcgccgag
gccgcgggctcaggggagactctgtcggtggatcagttagtgacgttcctgcagcaccag
cagcgggaggaggcggcagggcctgcgctggccctctccctcattgagcgctacgagccc
agcgagactgccaaggcgcagcggcagatgaccaaggacggcttcctcatgtacttactg
tcggctgacggcagcgccttcagcctggcacaccgccgtgtctaccaggacatgggccag
ccacttagccactacctggtgtcctcttcacacaacacctacctgctggaggaccagcta
gccgggcccagcagcactgaagcctacatccgggcactgtgcaaaggctgccgatgcctg
gagcttgactgctgggacgggcccaaccaggaaccaatcatctaccacggctatactttc
acttccaagatcctcttctgcgatgtgctcagggccatccgggactatgccttcaaggcg
tccccctaccctgtcatcctatccctggagaaccactgcacactggagcagcagcgcgtg
atggcgcggcacctgcatgccatcctgggccccatgctgttgaaccgaccactggatggg
gtcaccaacagcctgccctcccctgagcaactgaaggggaagatcctgctgaaggggaag
aagctcggggggctcctgccccctggaggggagggtggccctgaggccactgtggtgtca
gacgaagacgaggctgctgagatggaggatgaggcagtgaggagccgtgtgcagcacaag
cccaaggaggacaagctcaggctagcacaggagctctctgacatggtcatttactgcaag
agtgtccactttgggggcttctccagtcctggcacccctggacaggccttctacgagatg
gcgtccttctctgagaaccgtgcccttcgactgctccaagaatcaggaaacggctttgtc
cgccacaacgtggggcacctgagcagaatctacccggctggatggagaacagactcctcc
aactacagccccgtggagatgtggaatgggggctgccagatcgtggccctgaatttccag
acacctgggccagagatggacgtgtaccagggccgcttccaggacaacggggcctgtggg
tacgtgctgaagcccgccttcctgcgagaccccaacggcacctttaacccccgcgccctg
gctcaggggccctggtgggcacggaagcggctcaacatcagggtcatttcggggcagcag
ctgccaaaagtcaacaagaataagaattcaattgtggaccccaaagtgacagtggagatc
catggcgtgagccgggacgtggccagccgccagactgctgtcatcaccaacaatggtttc
aacccatggtgggacacggagtttgcgtttgaggtagttgtgcctgaccttgccctcatc
cgcttcttggtggaagattatgatgcctcctccaagaatgacttcattggccagagtacc
atccccttgaacagcctcaagcaaggataccgccatgtccacctcatgtctaagaacggg
gaccagcatccatcagccaccctctttgtgaagatctccctccaggactag

KEGG   Homo sapiens (human): 5335Help
Entry
5335              CDS       T01001                                 

Gene name
PLCG1, NCKAP3, PLC-II, PLC1, PLC148, PLCgamma1
Definition
(RefSeq) phospholipase C gamma 1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04670  Leukocyte transendothelial migration
hsa04722  Neurotrophin signaling pathway
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04919  Thyroid hormone signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05135  Yersinia infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05214  Glioma
hsa05223  Non-small cell lung cancer
hsa05225  Hepatocellular carcinoma
hsa05231  Choline metabolism in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Network
nt06120  Calcium signaling (virus)
nt06124  Chemokine signaling (virus)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06210  ERK signaling
nt06220  Calcium signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06273  Glioma
  Element
N00023  EGF-EGFR-PLCG-ERK signaling pathway
N00024  Mutation-activated EGFR to PLCG-ERK signaling pathway
N00025  EML4-ALK fusion kinase to PLCG-ERK signaling pathway
N00026  EGF-EGFR-PLCG-CAMK signaling pathway
N00027  Amplified EGFR to PLCG-CAMK signaling pathway
N00028  PDGF-PDGFR-PLCG-CAMK signaling pathway
N00029  Amplified PDGFR to PLCG-CAMK signaling pathway
N00147  EGF-EGFR-PLCG-calcineurin signaling pathway
N00172  KSHV K15 to PLCG-calcineurin signaling pathway
N00227  TGFA-EGFR-PLCG-PKC signaling pathway
N00228  TGFA-overexpression to PLCG-PKC signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00432  HIV gp120 to CXCR4-GNAQ-PLCB/G-calcineurin
N00546  CXCL12-CXCR4-PKC-ERK signaling pathaway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5335 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5335 (PLCG1)
   04015 Rap1 signaling pathway
    5335 (PLCG1)
   04012 ErbB signaling pathway
    5335 (PLCG1)
   04370 VEGF signaling pathway
    5335 (PLCG1)
   04064 NF-kappa B signaling pathway
    5335 (PLCG1)
   04066 HIF-1 signaling pathway
    5335 (PLCG1)
   04020 Calcium signaling pathway
    5335 (PLCG1)
   04070 Phosphatidylinositol signaling system
    5335 (PLCG1)
   04072 Phospholipase D signaling pathway
    5335 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    5335 (PLCG1)
   04660 T cell receptor signaling pathway
    5335 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    5335 (PLCG1)
   04659 Th17 cell differentiation
    5335 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    5335 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    5335 (PLCG1)
   04670 Leukocyte transendothelial migration
    5335 (PLCG1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    5335 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    5335 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5335 (PLCG1)
  09158 Development
   04360 Axon guidance
    5335 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5335 (PLCG1)
   05206 MicroRNAs in cancer
    5335 (PLCG1)
   05205 Proteoglycans in cancer
    5335 (PLCG1)
   05231 Choline metabolism in cancer
    5335 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    5335 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    5335 (PLCG1)
   05214 Glioma
    5335 (PLCG1)
   05223 Non-small cell lung cancer
    5335 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    5335 (PLCG1)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    5335 (PLCG1)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5335 (PLCG1)
   05135 Yersinia infection
    5335 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    5335 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5335 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    5335 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5335 (PLCG1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     5335 (PLCG1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    5335 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    5335 (PLCG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 PH SH3_1 SH3_9 SH3_2 PH_12 GDPD
Motif
Other DBs
NCBI-GeneID: 5335
NCBI-ProteinID: NP_877963
OMIM: 172420
HGNC: 9065
Ensembl: ENSG00000124181
Vega: OTTHUMG00000033082
Pharos: P19174(Tchem)
UniProt: P19174 Q4LE43
LinkDB All DBs
Structure
PDB: 

Position
20q12
AA seq 1290 aa AA seqDB search
MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAPTPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLEASTLRA
GERPELCRVSLPEFQQFLLDYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVEISADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSMM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSS
STELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFIKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVNPVALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKIMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMTGRHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCAISIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL
ELASLLIKIDIFPAKENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDF
RISQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3873 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgccgcgtccccttgcgccaacggctgcgggcccggcgcgccctcggacgcc
gaggtgctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcgacccgagcggaagaccttccaggtcaagctggagacgcgccagatc
acgtggagccggggcgccgacaagatcgagggggccattgacattcgtgaaattaaggag
atccgcccagggaagacctcacgggactttgatcgctatcaagaggacccagctttccgg
ccggaccagtcacattgctttgtcattctctatggaatggaatttcgcctgaaaacgctg
agcctgcaagccacatctgaggatgaagtgaacatgtggatcaagggcttaacttggctg
atggaggatacattgcaggcacccacacccctgcagattgagaggtggctccggaagcag
ttttactcagtggatcggaatcgtgaggatcgtatatcagccaaggacctgaagaacatg
ctgtcccaggtcaactaccgggtccccaacatgcgcttcctccgagagcggctgacggac
ctggagcagcgcagcggggacatcacctacgggcagtttgctcagctgtaccgcagcctc
atgtacagcgcccagaagacgatggacctccccttcttggaagccagtactctgagggct
ggggagcggccggagctttgccgagtgtcccttcctgagttccagcagttccttcttgac
taccagggggagctgtgggctgttgatcgcctccaggtgcaggagttcatgctcagcttc
ctccgagaccccttacgagagatcgaggagccatacttcttcctggatgagtttgtcacc
ttcctgttctccaaagagaacagtgtgtggaactcgcagctggatgcagtatgcccggac
accatgaacaaccctctttcccactactggatctcctcctcgcacaacacgtacctgacc
ggggaccagttctccagtgagtcctccttggaagcctatgctcgctgcctgcggatgggc
tgtcgctgcattgagttggactgctgggacggcccggatgggatgccagttatttaccat
gggcacacccttaccaccaagatcaagttctcagatgtcctgcacaccatcaaggagcat
gcctttgtggcctcagagtacccagtcatcctgtccattgaggaccactgcagcattgcc
cagcagagaaacatggcccaatacttcaagaaggtgctgggggacacactcctcaccaag
cccgtggagatctctgccgacgggctcccctcacccaaccagcttaagaggaagatcctc
atcaagcacaagaagctggctgagggcagtgcctacgaggaggtgcctacatccatgatg
tactctgagaacgacatcagcaactctatcaagaatggcatcctctacctggaggaccct
gtgaaccacgaatggtatccccactactttgttctgaccagcagcaagatctactactct
gaggagaccagcagtgaccagggcaacgaggatgaggaggagcccaaggaggtcagcagc
agcacagagctgcactccaatgagaagtggttccatgggaagctaggggcagggcgtgac
gggcgtcacatcgctgagcgcctgcttactgagtactgcatcgagaccggagcccctgac
ggctccttcctcgtgcgagagagtgagaccttcgtgggcgactacacgctctctttctgg
cggaacgggaaagtccagcactgccgtatccactcccggcaagatgctgggacccccaag
ttcttcttgacagacaacctcgtctttgactccctctatgacctcatcacgcactaccag
caggtgcccctgcgctgtaatgagtttgagatgcgactttcagagcctgtcccacagacc
aacgcccacgagagcaaagagtggtaccacgcgagcctgaccagagcacaggctgagcac
atgctaatgcgcgtccctcgtgatggggccttcctggtgcggaagcggaatgaacccaac
tcatatgccatctctttccgggctgagggcaagatcaagcattgccgtgtccagcaagag
ggccagacagtgatgctagggaactcggagttcgacagccttgttgacctcatcagctac
tatgagaaacacccgctataccgcaagatgaagctgcgctatcccatcaacgaggaggca
ctggagaagattggcacagctgagcctgactacggggccctgtatgagggacgcaaccct
ggcttctatgtagaggcaaaccctatgccaactttcaagtgtgcagtcaaagccctcttt
gactacaaggcccagagggaggacgagctgaccttcatcaagagcgccatcatccagaat
gtggagaagcaagagggaggctggtggcgaggggactacggagggaagaagcagctgtgg
ttcccatcaaactacgtggaagagatggtcaaccccgtggccctggagccggagagggag
cacttggacgagaacagccccctaggggacttgctgcggggggtcttggatgtgccggct
tgtcagattgccatccgtcctgagggcaagaacaaccggctcttcgtcttctccatcagc
atggcgtcggtggcccactggtccctggatgttgctgccgactcacaggaggagctgcag
gactgggtgaaaaagatccgtgaagtggcccagacagcagacgccaggctcactgaaggg
aagataatggaacggaggaagaagattgccctggagctctctgaacttgtcgtctactgc
cggcctgttccctttgatgaagagaagattggcacagaacgtgcttgctaccgggacatg
tcatccttcccggaaaccaaggctgagaaatacgtgaacaaggccaaaggcaagaagttc
cttcagtacaatcgactgcagctctcccgcatctaccccaagggccagcgactggattcc
tccaactacgatcctttgcccatgtggatctgtggcagtcagcttgtggccctcaacttc
cagacccctgacaagcctatgcagatgaaccaggccctcttcatgacgggcaggcactgt
ggctacgtgctgcagccaagcaccatgcgggatgaggccttcgacccctttgacaagagc
agcctccgcgggctggagccatgtgccatctctattgaggtgctgggggcccgacatctg
ccaaagaatggccgaggcattgtgtgtccttttgtggagattgaggtggctggagctgag
tatgacagcaccaagcagaagacagagtttgtggtggacaatggactcaaccctgtatgg
ccagccaagcccttccacttccagatcagtaaccctgaatttgcctttctgcgcttcgtg
gtgtatgaggaagacatgtttagtgaccagaatttcctggctcaggctactttcccagta
aaaggcctgaagacaggatacagagcagtgcctttgaagaacaactacagtgaggacctg
gagttggcctccctgctgatcaagattgacattttccctgccaaggagaatggtgacctc
agtcccttcagtggtacgtccctgcgggagcggggctcagatgcctcaggccagctgttt
catggccgagcccgggaaggctcctttgaatcccgctaccagcagccgtttgaggacttc
cgcatctcccaggagcatctcgcagaccattttgacagtcgagaacgaagggccccaaga
aggactcgggtcaatggagacaaccgcctctag

KEGG   Homo sapiens (human): 5336Help
Entry
5336              CDS       T01001                                 

Gene name
PLCG2, APLAID, FCAS3, PLC-IV, PLC-gamma-2
Definition
(RefSeq) phospholipase C gamma 2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04020  Calcium signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04611  Platelet activation
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04670  Leukocyte transendothelial migration
hsa04722  Neurotrophin signaling pathway
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04919  Thyroid hormone signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05214  Glioma
hsa05223  Non-small cell lung cancer
hsa05225  Hepatocellular carcinoma
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Network
nt06120  Calcium signaling (virus)
nt06124  Chemokine signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06210  ERK signaling
nt06220  Calcium signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06273  Glioma
  Element
N00023  EGF-EGFR-PLCG-ERK signaling pathway
N00024  Mutation-activated EGFR to PLCG-ERK signaling pathway
N00025  EML4-ALK fusion kinase to PLCG-ERK signaling pathway
N00026  EGF-EGFR-PLCG-CAMK signaling pathway
N00027  Amplified EGFR to PLCG-CAMK signaling pathway
N00028  PDGF-PDGFR-PLCG-CAMK signaling pathway
N00029  Amplified PDGFR to PLCG-CAMK signaling pathway
N00147  EGF-EGFR-PLCG-calcineurin signaling pathway
N00172  KSHV K15 to PLCG-calcineurin signaling pathway
N00180  KSHV K1 to PLCG-calcineurin signaling pathway
N00227  TGFA-EGFR-PLCG-PKC signaling pathway
N00228  TGFA-overexpression to PLCG-PKC signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00432  HIV gp120 to CXCR4-GNAQ-PLCB/G-calcineurin
N00487  BCR-PLCG-Calcineurin signaling pathway
N00488  EBV LMP2A to BCR signaling pathway
N00546  CXCL12-CXCR4-PKC-ERK signaling pathaway
Disease
H01743  Autoinflammation and PLCG2-associated antibody deficiency and immune dysregulation
H02159  Familial cold autoinflammatory syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5336 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5336 (PLCG2)
   04012 ErbB signaling pathway
    5336 (PLCG2)
   04370 VEGF signaling pathway
    5336 (PLCG2)
   04064 NF-kappa B signaling pathway
    5336 (PLCG2)
   04066 HIF-1 signaling pathway
    5336 (PLCG2)
   04020 Calcium signaling pathway
    5336 (PLCG2)
   04070 Phosphatidylinositol signaling system
    5336 (PLCG2)
   04072 Phospholipase D signaling pathway
    5336 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5336 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    5336 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    5336 (PLCG2)
   04662 B cell receptor signaling pathway
    5336 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    5336 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    5336 (PLCG2)
   04670 Leukocyte transendothelial migration
    5336 (PLCG2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    5336 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    5336 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5336 (PLCG2)
  09158 Development
   04360 Axon guidance
    5336 (PLCG2)
   04380 Osteoclast differentiation
    5336 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5336 (PLCG2)
   05206 MicroRNAs in cancer
    5336 (PLCG2)
   05205 Proteoglycans in cancer
    5336 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    5336 (PLCG2)
   05214 Glioma
    5336 (PLCG2)
   05223 Non-small cell lung cancer
    5336 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    5336 (PLCG2)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    5336 (PLCG2)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5336 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    5336 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5336 (PLCG2)
   05169 Epstein-Barr virus infection
    5336 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    5336 (PLCG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5336 (PLCG2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     5336 (PLCG2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    5336 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    5336 (PLCG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 SH3_9 PH SH3_2 PH_12 PH_14 EF-hand_like GDPD
Motif
Other DBs
NCBI-GeneID: 5336
NCBI-ProteinID: NP_002652
OMIM: 600220
HGNC: 9066
Ensembl: ENSG00000197943
Vega: OTTHUMG00000176532
Pharos: P16885(Tchem)
UniProt: P16885
LinkDB All DBs
Structure
PDB: 

Position
16q23.3
AA seq 1265 aa AA seqDB search
MSTTVNVDSLAEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTILYGTQFVLSTLSLAADSKEDAV
NWLSGLKILHQEAMNASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLINFKVSSA
KFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VYLHDFQRFLIHEQQEHWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDAVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLRMGCRCIELDC
WDGPDGKPVIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCSVEQQRHMAKA
FKEVFGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTMEEEVPQDIPPTELHFGEKWFHKKVEKR
TSAEKLLQEYCMETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTLKYY
LTDNLTFSSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDSLSRGEAEDML
MRIPRDGAFLIRKREGSDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHSLYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKRSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADFEELEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGDPPVEFATDRVEELFEWF
QSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSIIRQKPVDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKY
MQMNHALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLTVKVLGARHLPKLGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPIWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKAVKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFSVNENQLQLYQEKCNKRLREKRVSN
SKFYS
NT seq 3798 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccacggtcaatgtagattcccttgcggaatatgagaagagccagatcaagaga
gccctggagctggggacggtgatgactgtgttcagcttccgcaagtccacccccgagcgg
agaaccgtccaggtgatcatggagacgcggcaggtggcctggagcaagaccgctgacaag
atcgagggcttcttggatatcatggaaataaaagaaatccgcccagggaagaactccaaa
gatttcgagcgagcaaaagcagttcgccagaaagaagactgctgcttcaccatcctatat
ggcactcagttcgtcctcagcacgctcagcttggcagctgactctaaagaggatgcagtt
aactggctctctggcttgaaaatcttacaccaggaagcgatgaatgcgtccacgcccacc
attatcgagagttggctgagaaagcagatatattctgtggatcaaaccagaagaaacagc
atcagtctccgagagttgaagaccatcttgcccctgatcaactttaaagtgagcagtgcc
aagttccttaaagataagtttgtggaaataggagcacacaaagatgagctcagctttgaa
cagttccatctcttctataaaaaacttatgtttgaacagcaaaaatcgattctcgatgaa
ttcaaaaaggattcgtccgtgttcatcctggggaacactgacaggccggatgcctctgct
gtttacctgcatgacttccagaggtttctcatacatgaacagcaggagcattgggctcag
gatctgaacaaagtccgtgagcggatgacaaagttcattgatgacaccatgcgtgaaact
gctgagcctttcttgtttgtggatgagttcctcacgtacctgttttcacgagaaaacagc
atctgggatgagaagtatgacgcggtggacatgcaggacatgaacaaccccctgtctcat
tactggatctcctcgtcacataacacgtaccttacaggtgaccagctgcggagcgagtcg
tccccagaagcttacatccgctgcctgcgcatgggctgtcgctgcattgaactggactgc
tgggacgggcccgatgggaagccggtcatctaccatggctggacgcggactaccaagatc
aagtttgacgacgtcgtgcaggccatcaaagaccacgcctttgttacctcgagcttccca
gtgatcctgtccatcgaggagcactgcagcgtggagcaacagcgtcacatggccaaggcc
ttcaaggaagtatttggcgacctgctgttgacgaagcccacggaggccagtgctgaccag
ctgccctcgcccagccagctgcgggagaagatcatcatcaagcataagaagctgggcccc
cgaggcgatgtggatgtcaacatggaggacaagaaggacgaacacaagcaacagggggag
ctgtacatgtgggattccattgaccagaaatggactcggcactactgcgccattgccgat
gccaagctgtccttcagtgatgacattgaacagactatggaggaggaagtgccccaggat
ataccccctacagaactacattttggggagaaatggttccacaagaaggtggagaagagg
acgagtgccgagaagttgctgcaggaatactgcatggagacggggggcaaggatggcacc
ttcctggttcgggagagcgagaccttccccaatgactacaccctgtccttctggcggtca
ggccgggtccagcactgccggatccgctccaccatggagggcgggaccctgaaatactac
ttgactgacaacctcaccttcagcagcatctatgccctcatccagcactaccgcgagacg
cacctgcgctgcgccgagttcgagctgcggctcacggaccctgtgcccaaccccaacccc
cacgagtccaagccgtggtactatgacagcctgagccgcggagaggcagaggacatgctg
atgaggattccccgggacggggccttcctgatccggaagcgagaggggagcgactcctat
gccatcaccttcagggctaggggcaaggtaaagcattgtcgcatcaaccgggacggccgg
cactttgtgctggggacctccgcctattttgagagtctggtggagctcgtcagttactac
gagaagcattcactctaccgaaagatgagactgcgctaccccgtgacccccgagctcctg
gagcgctacaatatggaaagagatataaactccctctacgacgtcagcagaatgtatgtg
gatcccagtgaaatcaatccgtccatgcctcagagaaccgtgaaagctctgtatgactac
aaagccaagcgaagcgatgagctgagcttctgccgtggtgccctcatccacaatgtctcc
aaggagcccgggggctggtggaaaggagactatggaaccaggatccagcagtacttccca
tccaactacgtcgaggacatctcaactgcagacttcgaggagctagaaaagcagattatt
gaagacaatcccttagggtctctttgcagaggaatattggacctcaatacctataacgtc
gtgaaagcccctcagggaaaaaaccagaagtcctttgtcttcatcctggagcccaagcag
cagggcgatcctccggtggagtttgccacagacagggtggaggagctctttgagtggttt
cagagcatccgagagatcacctggaagattgacaccaaggagaacaacatgaagtactgg
gagaagaaccagtccatcgccatcgagctctctgacctggttgtctactgcaaaccaacc
agcaaaaccaaggacaacttagaaaatcctgacttccgagaaatccgctcctttgtggag
acgaaggctgacagcatcatcagacagaagcccgtcgacctcctgaagtacaatcaaaag
ggcctgacccgcgtctacccaaagggacaaagagttgactcttcaaactacgaccccttc
cgcctctggctgtgcggttctcagatggtggcactcaatttccagacggcagataagtac
atgcagatgaatcacgcattgttttctctcaatgggcgcacgggctacgttctgcagcct
gagagcatgaggacagagaaatatgacccgatgccacccgagtcccagaggaagatcctg
atgacgctgacagtcaaggttctcggtgctcgccatctccccaaacttggacgaagtatt
gcctgtccctttgtagaagtggagatctgtggagccgagtatgacaacaacaagttcaag
acgacggttgtgaatgataatggcctcagccctatctgggctccaacacaggagaaggtg
acatttgaaatttatgacccaaacctggcatttctgcgctttgtggtttatgaagaagat
atgttcagcgatcccaactttcttgctcatgccacttaccccattaaagcagtcaaatca
ggattcaggtccgttcctctgaagaatgggtacagcgaggacatagagctggcttccctc
ctggttttctgtgagatgcggccagtcctggagagcgaagaggaactttactcctcctgt
cgccagctgaggaggcggcaagaagaactgaacaaccagctctttctgtatgacacacac
cagaacttgcgcaatgccaaccgggatgccctggttaaagagttcagtgttaatgagaac
cagctccagctgtaccaggagaaatgcaacaagaggttaagagagaagagagtcagcaac
agcaagttttactcatag

KEGG   Homo sapiens (human): 84812Help
Entry
84812             CDS       T01001                                 

Gene name
PLCD4
Definition
(RefSeq) phospholipase C delta 4
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04919  Thyroid hormone signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    84812 (PLCD4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    84812 (PLCD4)
   04070 Phosphatidylinositol signaling system
    84812 (PLCD4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    84812 (PLCD4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    84812 (PLCD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    84812 (PLCD4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     84812 (PLCD4)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    84812 (PLCD4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    84812 (PLCD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 PH GDPD PH_12 EF-hand_8 Wap1 SBP_bac_5
Motif
Other DBs
NCBI-GeneID: 84812
NCBI-ProteinID: NP_116115
OMIM: 605939
HGNC: 9062
Ensembl: ENSG00000115556
Vega: OTTHUMG00000154743
Pharos: Q9BRC7(Tbio)
UniProt: Q9BRC7
LinkDB All DBs
Position
2q35
AA seq 762 aa AA seqDB search
MASLLQDQLTTDQDLLLMQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPS
FSISDVETIRNGHDSELLRSLAEELPLEQGFTIVFHGRRSNLDLMANSVEEAQIWMRGLQ
LLVDLVTSMDHQERLDQWLSDWFQRGDKNQDGKMSFQEVQRLLHLMNVEMDQEYAFSLFQ
AADTSQSGTLEGEEFVQFYKALTKRAEVQELFESFSADGQKLTLLEFLDFLQEEQKERDC
TSELALELIDRYEPSDSGKLRHVLSMDGFLSYLCSKDGDIFNPACLPIYQDMTQPLNHYF
ICSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDVWDGPSGEPVVYHGHTLTSRILF
KDVVATVAQYAFQTSDYPVILSLETHCSWEQQQTMARHLTEILGEQLLSTTLDGVLPTQL
PSPEELRRKILVKGKKLTLEEDLEYEEEEAEPELEESELALESQFETEPEPQEQNLQNKD
KKKKSKPILCPALSSLVIYLKSVSFRSFTHSKEHYHFYEISSFSETKAKRLIKEAGNEFV
QHNTWQLSRVYPSGLRTDSSNYNPQELWNAGCQMVAMNMQTAGLEMDICDGHFRQNGGCG
YVLKPDFLRDIQSSFHPEKPISPFKAQTLLIQVISGQQLPKVDKTKEGSIVDPLVKVQIF
GVRLDTARQETNYVENNGFNPYWGQTLCFRVLVPELAMLRFVVMDYDWKSRNDFIGQYTL
PWTCMQQGYRHIHLLSKDGISLRPASIFVYICIQEGLEGDES
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccctgctgcaagaccagctgaccactgatcaggacttgctgctgatgcaggaa
ggcatgccgatgcgcaaggtgaggtccaaaagctggaagaagctaagatacttcagactt
cagaatgacggcatgacagtctggcatgcacggcaggccaggggcagtgccaagcccagc
ttctcaatctctgatgtggagacaatacgtaatggccatgattccgagttgctgcgtagc
ctggcagaggagctccccctggagcagggcttcaccattgtcttccatggccgccgctcc
aacctggacctgatggccaacagtgttgaggaggcccagatatggatgcgagggctccag
ctgttggtggatcttgtcaccagcatggaccatcaggagcgcctggaccaatggctgagc
gattggtttcaacgtggagacaaaaatcaggatggtaagatgagtttccaagaagttcag
cggttattgcacctaatgaatgtggaaatggaccaagaatatgccttcagtctttttcag
gcagcagacacgtcccagtctggaaccctggaaggagaagaattcgtacagttctataag
gcattgactaaacgtgctgaggtgcaggaactgtttgaaagtttttcagctgatgggcag
aagctgactctgctggaatttttggatttcctccaagaggagcagaaggagagagactgc
acctctgagcttgctctggaactcattgaccgctatgaaccttcagacagtggcaaactg
cggcatgtgctgagtatggatggcttcctcagctacctctgctctaaggatggagacatc
ttcaacccagcctgcctccccatctatcaggatatgactcaacccctgaaccactacttc
atctgctcttctcataacacctacctagtgggggaccagctttgtggccagagcagcgtc
gagggatatatacgggccctgaagcgggggtgccgctgcgtggaggtggatgtatgggat
ggacctagcggggaacctgtcgtttaccacggacacaccctgacctcccgcatcctgttc
aaagatgtcgtggccacagtagcacagtatgccttccagacatcagactacccagtcatc
ttgtccctggagacccactgcagctgggagcagcagcagaccatggcccgtcatctgact
gagatcctgggggagcagctgctgagcaccaccttggatggggtgctgcccactcagctg
ccctcgcctgaggagcttcggaggaagatcctggtgaaggggaagaagttaacacttgag
gaagacctggaatatgaggaagaggaagcagaacctgagttggaagagtcagaattggcg
ctggagtcccagtttgagactgagcctgagccccaggagcagaaccttcagaataaggac
aaaaagaagaaatccaagcccatcttgtgtccagccctctcttccctggttatctacttg
aagtctgtctcattccgcagcttcacacattcaaaggagcactaccacttctacgagata
tcatctttctctgaaaccaaggccaagcgcctcatcaaggaggctggcaatgagtttgtg
cagcacaatacttggcagttaagccgtgtgtatcccagcggcctgaggacagactcttcc
aactacaacccccaggaactctggaatgcaggctgccagatggtggccatgaatatgcag
actgcagggcttgaaatggacatctgtgatgggcatttccgccagaatggcggctgtggc
tatgtgctgaagccagacttcctgcgtgatatccagagttctttccaccctgagaagccc
atcagccctttcaaagcccagactctcttaatccaggtgatcagcggtcagcaactcccc
aaagtggacaagaccaaagaggggtccattgtggatccactggtgaaagtgcagatcttt
ggcgttcgtctagacacagcacggcaggagaccaactatgtggagaacaatggttttaat
ccatactgggggcagacactatgtttccgggtgctggtgcctgaacttgccatgctgcgt
tttgtggtaatggattatgactggaaatcccgaaatgactttattggtcagtacaccctg
ccttggacctgcatgcaacaaggttaccgccacattcacctgctgtccaaagatggcatc
agcctccgcccagcttccatctttgtgtatatctgcatccaggaaggcctggagggggat
gagtcctga

KEGG   Homo sapiens (human): 89869Help
Entry
89869             CDS       T01001                                 

Gene name
PLCZ1, NYD-SP27, PLC-zeta-1, PLCzeta, SPGF17
Definition
(RefSeq) phospholipase C zeta 1
  KO
K05861  phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04114  Oocyte meiosis
hsa04919  Thyroid hormone signaling pathway
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Disease
H01282  Spermatogenic failure
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    89869 (PLCZ1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    89869 (PLCZ1)
   04070 Phosphatidylinositol signaling system
    89869 (PLCZ1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    89869 (PLCZ1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    89869 (PLCZ1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    89869 (PLCZ1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     89869 (PLCZ1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    89869 (PLCZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like C2 EF-hand_10 EF-hand_7 EF-hand_6
Motif
Other DBs
NCBI-GeneID: 89869
NCBI-ProteinID: NP_149114
OMIM: 608075
HGNC: 19218
Ensembl: ENSG00000139151
Vega: OTTHUMG00000168937
Pharos: Q86YW0(Tbio)
UniProt: Q86YW0 A0A140VJR9
LinkDB All DBs
Position
12p12.3
AA seq 608 aa AA seqDB search
MEMRWFLSKIQDDFRGGKINLEKTQRLLEKLDIRCSYIHVKQIFKDNDRLKQGRITIEEF
RAIYRIITHREEIIEIFNTYSENRKILLASNLAQFLTQEQYAAEMSKAIAFEIIQKYEPI
EEVRKAHQMSLEGFTRYMDSRECLLFKNECRKVYQDMTHPLNDYFISSSHNTYLVSDQLL
GPSDLWGYVSALVKGCRCLEIDCWDGAQNEPVVYHGYTLTSKLLFKTVIQAIHKYAFMTS
DYPVVLSLENHCSTAQQEVMADNLQATFGESLLSDMLDDFPDTLPSPEALKFKILVKNKK
IGTLKETHERKGSDKRGDNQDKETGVKKLPGVMLFKKKKTRKLKIALALSDLVIYTKAEK
FKSFQHSRLYQQFNENNSIGETQARKLSKLRVHEFIFHTRKFITRIYPKATRADSSNFNP
QEFWNIGCQMVALNFQTPGLPMDLQNGKFLDNGGSGYILKPHFLRESKSYFNPSNIKEGM
PITLTIRLISGIQLPLTHSSSNKGDSLVIIEVFGVPNDQMKQQTRVIKKNAFSPRWNETF
TFIIHVPELALIRFVVEGQGLIAGNEFLGQYTLPLLCMNKGYRRIPLFSRMGESLEPASL
FVYVWYVR
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgagatggtttttgtcaaagattcaggatgacttcagaggtggaaaaattaac
ctagaaaaaactcagaggttacttgaaaaattagatattcggtgcagttatattcatgtg
aaacagatttttaaggacaatgacaggctgaaacaaggaagaatcaccatagaagaattt
agagcaatttatcgaattatcacgcacagagaagaaattattgagattttcaacacatat
tctgaaaaccggaaaattcttttagcaagtaatctggctcaatttctgacacaagaacaa
tatgcagctgagatgagtaaagctattgcttttgagatcattcagaaatacgagcctatc
gaagaagttaggaaagcacaccaaatgtcattagaaggttttacaagatacatggattca
cgtgaatgtctactgtttaaaaatgaatgtagaaaagtttatcaagatatgactcatcca
ttaaatgattattttatttcatcttcacataacacatatttggtatctgatcaattattg
ggaccaagtgacctttggggatatgtaagtgcccttgtgaaaggatgccgttgtttggag
attgactgctgggatggagcacaaaatgaacctgttgtatatcatggctacacactcaca
agcaaacttctgtttaaaactgttatccaagctatacacaagtatgcattcatgacatct
gactacccagtggtgctctctttagaaaatcactgctccactgcccaacaagaagtaatg
gcagacaatttgcaggctacttttggagagtccttgctttctgatatgcttgatgatttt
cctgatactctaccatcaccagaggcactaaaattcaaaatattagttaaaaataagaaa
ataggaaccttaaaggaaacccatgaaagaaaaggttctgataagcgtggagacaatcaa
gacaaggaaacaggggtaaaaaagttacctggagtaatgcttttcaagaaaaagaagacc
aggaagctaaaaattgctctggccttatctgatcttgtcatttatacgaaagctgagaaa
ttcaaaagctttcaacattcaagattatatcagcaatttaatgaaaataattctattggg
gagacacaagcccgaaaactttcaaaattgcgagtccatgagtttatttttcacaccagg
aagttcattaccagaatatatcccaaagcaacaagagcagactcttctaattttaatccc
caagaattttggaatataggttgtcaaatggtggctttaaatttccagacccctggtctg
cccatggatctgcaaaatgggaaatttttggataatggtggttctggatatattttgaaa
ccacatttcttaagagagagtaaatcatactttaacccaagtaacataaaagagggtatg
ccaattacacttacaataaggctcatcagtggtatccagttgcctcttactcattcatca
tctaacaaaggtgattcattagtaattatagaagtttttggtgttccaaatgatcaaatg
aagcagcagactcgtgtaattaaaaaaaatgcttttagtccaagatggaatgaaacattc
acatttattattcatgtcccagaattggcattgatacgttttgttgttgaaggtcaaggt
ttaatagcaggaaatgaatttcttgggcaatatactttgccacttctatgcatgaacaaa
ggttatcgtcgtattcctctgttttccagaatgggtgagagccttgagcctgcttcactg
tttgtttatgtttggtacgtcagataa

DBGET integrated database retrieval system