KEGG   Homo sapiens (human): 113146
Entry
113146            CDS       T01001                                 

Gene name
AHNAK2, C14orf78
Definition
(RefSeq) AHNAK nucleoprotein 2
  KO
K23934  neuroblast differentiation-associated protein AHNAK
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113146 (AHNAK2)
SSDB
Motif
Pfam: DUF4097 AsmA_2 PDZ
Other DBs
NCBI-GeneID: 113146
NCBI-ProteinID: NP_612429
OMIM: 608570
HGNC: 20125
Ensembl: ENSG00000185567
Vega: OTTHUMG00000170765
Pharos: Q8IVF2(Tdark)
UniProt: Q8IVF2
LinkDB
Structure
PDB: 
4CN0

Position
14q32.33
AA seq 5795 aa
MCDCFHMVLPTWPGTPGSVSGRQLQPGEPGAETEDDHSVTEGPADEGIRPRPQGSSPVYE
YTTEAADFGLQEDAPGRQGSAGRRRSWWKRDSGDSRTFFRMSRPEAVQEATEVTLKTEVE
AGASGYSVTGGGDQGIFVKQVLKDSSAAKLFNLREGDQLLSTTVFFENIKYEDALKILQY
SEPYKVQFKIRRQLPAPQDEEWASSDAQHGPQGKEKEDTDVADGCRETPTKTLEGDGDQE
RLISKPRVGRGRQSQRERLSWPKFQSIKSKRGPGPQRSHSSSEAYEPRDAHDVSPTSTDT
EAQLTVERQEQKAGPGSQRRRKFLNLRFRTGSGQGPSSTGQPGRGFQSGVGRAGVLEELG
PWGDSLEETGAATGSRREERAEQDREVMPAQSMPLPTELGDPRLCEGTPQEGGLRAARLH
GKTLEGQAQETAVAQRKPRAQPTPGMSREGEGEGLQSLEIGIARLSLRDTTEGGTQIGPP
EIRVRVHDLKTPKFAFSTEKEPERERRLSTPQRGKRQDASSKAGTGLKGEEVEGAGWMPG
REPTTHAEAQGDEGDGEEGLQRTRITEEQDKGREDTEGQIRMPKFKIPSLGWSPSKHTKT
GREKATEDTEQGREGEATATADRREQRRTEEGLKDKEDSDSMTNTTKIQLIHDEKRLKKE
QILTEKEVATKDSKFKMPKFKMPLFGASAPGKSMEASVDVSAPKVEADVSLLSMQGDLKT
TDLSVQTPSADLEVQDGQVDVKLPEGPLPEGASLKGHLPKVQRPSLKMPKVDLKGPKLDL
KGPKAEVTAPDVKMSLSSMEVDVQAPRAKLDGARLEGDLSLADKEVTAKDSKFKMPKFKM
PSFGVSAPGKSMEDSVDVSAPKVEADVSLSSMQGDLKATDLSIQPPSADLEVQAGQVDVK
LPEGPVPEGAGPKVHLPKVEMPSFKMPKVDLKGPQIDVKGPKLDLKGPKAEVTAPDGEVS
LPSMEVDVQAQKAKLDGAWLEGDLSLADKDVTAKDSKFKMPKFKMPSFGVSAPGKSIKAL
VDVSAPKVEADLSLPSMQGDLKTTDLSIQPASTDLKVQADQVDVKLPEGHLPEGAGLKGH
LPKVEMPSFKMPKVALKGPQVDVKGPKLDLKSPKAEVTAPDVEVSLPSVEVDVEAPGAKL
DSARLEGELSLADKDVTAKDSRFKMPKFKMPSFGASAPGKSIEASVDVSAPKVEADVSLP
SMQGDLKTTDLSIQPPSADLEVHAGQVDVKLLEGHVPEGAGFKGHLPKVQMPSLKMPKVD
LKGPQVEVRGPKLDLKGHKAEVTAHEVAVSLPSVEVDMQAPGAKLDGAQLDGDLSLADKD
VTAKDSKFKMPKFKMPSFGVSAPGKSIEASVDLSAPKVEADMSLPSMQGDLKTTDLSIQP
PSTDLELQAGQLDVKLPEGPVPEGAGLKGHLPKLQMPSFKVPKVDLKGPEIDIKGPKLDL
KDPKVEVTAPDVEVSLPSVEVDVEAPGAKLDGGRLEEDMSLADKDLTTKDSKFKMPKFKM
PSFGVSAPGKSIEASVDVSAPKVEADVSLPSMQGDLKATDLSIQPPSADLEVQAGQVDVK
LPEGPVSEGAGLKGHLPKVQMPSFKMPKVDLKGPQIDVKGPKLDLKGPKVEVTAPDVKMS
LSSMEVDVQAPRAKLDGAQLEGDLSLADKAVTAKDSKFKMPKFKMPSFGVSAPGKSIEAS
VDVSEPKVEADVSLPSMQGDLKTTDLSIQSPSADLEVQAGQVNVKLPEGPLPEGAGFKGH
LPKVQMPSLKMPKVALKGPQMDVKGPKLDLKGPKAEVMAPDVEVSLPSVEVDVEAPGAKL
DSVRLEGDLSLADKDVTAKDSKFKMPKFKMPSFGVSAPGKSIEASVDVSAPKVEAEVSLP
SMQGDLKTTDLCIPLPSADLVVQAGQVDMKLPEGQVPEGAGLKGHLPKVDMPSFKMPKVD
LKGPQTDVKGAKLDLKGPKAEVTAPDVEVSLPSMEVDVQAQKAKLDGARLEGDLSLADKD
MTAKDSKFKMPKFKMPSFGVSAPGRSIEASVDVPAPKVEADVSLPSMQGDLKTTDLSIQP
PSADLKVQTGQVDVKLPEGHVPEGAGLKGHLPKVEMPSLKMPKVDLKGPQVDIKGPKLDL
KDPKVEMRVPDVEVSLPSMEVDVQAPRAKLDSAHLQGDLTLANKDLTTKDSKFKMPKFKM
PSFGVSAPGKSIEASVDVSPPKVEADMSLPSMQGDLKTTDLSIQPLSADVKVQAGQVDVK
LLEGPVPEEVGLKGHLPKLQMPSFKVPKVDLKGPEIDIKGPKLDLKDPKVEVTAPDVEVS
LPSVEVDVKAPGAKLDGARLEGDMSLADKDVTAKDSKFKMPKFKMLSFGVSALGKSIEAS
ADVSALKVEADVSLPSMQGDLKTTDLSVQPPSADLEVQAGQVDVKLPEGPVPEGAGLKGH
LPKLQMPSFKMPKVDLKGPQIDVKGPKLDLKGPKTDVMAPDVEVSQPSVEVDVEAPGAKL
DGAWLEGDLSVADKDVTTKDSRFKIPKFKMPSFGVSAPGKSIEASVDVSAPKVEADGSLS
SMQGDLKATDLSIQPPSADLEVQAGQVDVKLPEGPVPEGAGLKGHLPKVQMPSFKMPEMD
LKGPQLDVKGPKLDLKGPKAEVTAPDVEMSLSSMEVDVQAPRAKLDGARLEGDLSLADKG
VTAKDSKFKMPKFKMPSFRVSAPGESIEALVDVSELKVEADMSLPSMQGDLKTTDISIQP
PSAQLEVQAGQVDVKLPEGHVPEGAGLKGHLPKLQMPSFKMPEVDLKGPQIDVKGPNVDL
KGPKAEVTAPDVKMSLSSMEVDVQAPRAKLDGARLEGDLSLADKGMTAKDSKFKMPKFKM
PSFGVSAPGKSIEASVDVSELKVEADGSFPSMQGDLKTTDIRIQPPSAQLEVQAGQVDVK
LPEGHVPEGAGLKGHLPKVQMPSFKMPKVDLKGPQIDVKGPKLDLKGPKAEVTAPDVEVS
LPSVEVDVEAPRAKLDGARLEGDLSLADKDVTAKDSKFKMPKFKMPSFGVSAPGKSIEVS
VDVSAPKVEAEVSLPSMQGDLKTTDISIEPPSAQLEVQAGQVDLKLPEGHVPEGAGLKGH
LPKLQMPSFKMPKVDRKGPQIDVKGPKLDLKGPKTDVTAPDVEVSQPGMEVDVEAPGAKL
DGARLEGDLSLADKDVTAKDSKFKMPKFKMPSFGVSAPGKSIEVLVDVSAPKVEADLSLP
SMQGDLKNTDISIEPPSAQLEVQAGQVDVKLPEGHVLEGAGLKGHLPKLQMPSFKMPKVD
RKGPQIDIKGPKLDLKGPKMDVTAPDVEVSQPSMEVDVEAPGAKLDGARLEGDLSLADKD
VTAKDSKFKMPKFKMPSYRASAPGKSIQASVDVSAPKAEADVSLPSMQGDLKTTDLSIQL
PSVDLEVQAGQVDVKLPEGHVPEGAGLKGHLPKVEMPSFKMPKVDLKSPQVDIKGPKLDL
KVPKAEVTVPDVEVSLPSVEVDVQAPRAKLDGARLEGDLSLAEKDVTAKDSKFKMPKFKM
PSFGVSAPGRSIEASLDVSAPKVEADVSLSSMQGDLKATDLSIQPPSADLEVQAVQVDVE
LLEGPVPEGAGLKGHLPKVEMPSLKTPKVDLKGPQIDVKGPKLDLKGPKAEVRVPDVEVS
LPSVEVDVQAPKAKLDAGRLEGDLSLADKDVTAKDSKFKMPKFKMPSFRVSAPGKSMEAS
VDVSAPKVEADVSLPSMQGDLKTTDLSIQPPSADLKVQAGQMDVKLPEGQVPEGAGLKEH
LPKVEMPSLKMPKVDLKGPQVDIKGPKLDLKVSKAEVTAPDVEVSLPSVEVDVQAPRAKL
DSAQLEGDLSLADKDVTAKDSKFKMPKFKMPSFGVSAPGKSIEASVHVSAPKVEADVSLP
SMQGDLKTTDLSIQPHSADLTVQARQVDMKLLEGHVPEEAGLKGHLPKVQMPSFKMPKVD
LKGPEIDIKGPKLDLKDPKVEVTAPDVEVSLPSVEVDVEAPGAKLDGARLEGDLSLADKD
MTAKDSKFKMPKFKMPSFGVSAPGKSMEASVDVTAPKVEADVSLPSMQGDLKATDLSVQP
PSADLEVQAGQVDVKLPEGPVPEGASLKGHLPKVQMPSFKMPKVDLKGPQIDVKGPKLDL
KGPKAEVTAPDVKMSLSSMEVDVQAPRAKLDGVQLEGDLSLADKDVTAKDSKFKMPKFKM
PSFGVSAPGKSMEASVDVSELKAKADVSLPSMQGDLKTTDLSIQSPSADLEVQAGQVDVK
LPEGPLPKGAGLKGHLPKVQMPCLKMPKVALKGPQVDVKGPKLDLKGPKADVMTPVVEVS
LPSMEVDVEAPGAKLDSVRLEGDLSLADKDMTAKDSKFKMPKFKMPSFGVSAPGKSIEAS
LDVSALKVEADVSLPSMQGDLKTTHLSIQPPSADLEVQAGQEDVKLPEGPVHEGAGLKGH
LPKLQMPSFKVPKVDLKGPQIDVNVPKLDLKGPKVEVTSPNLDVSLPSMEVDIQAPGAKL
DSTRLEGDLSLADKDVTAKDSKFKMPKFKMPSFGMLSPGKSIEVSVDVSAPKMEADMSIP
SMQGDLKTTDLRIQAPSADLEVQAGQVDLKLPEGHMPEVAGLKGHLPKVEMPSFKMPKVD
LKGPQVDVKGPKLDLKGPKAEVMAPDVEVSLPSVETDVQAPGSMLDGARLEGDLSLAHED
VAGKDSKFQGPKLSTSGFEWSSKKVSMSSSEIEGNVTFHEKTSTFPIVESVVHEGDLHDP
SRDGNLGLAVGEVGMDSKFKKLHFKVPKVSFSSTKTPKDSLVPGAKSSIGLSTIPLSSSE
CSSFELQQVSACSEPSMQMPKVGFAGFPSSRLDLTGPHFESSILSPCEDVTLTKYQVTVP
RAALAPELALEIPSGSQADIPLPKTECSTDLQPPEGVPTSQAESHSGPLNSMIPVSLGQV
SFPKFYKPKFVFSVPQMAVPEGDLHAAVGAPVMSPLSPGERVQCPLPSTQLPSPGTCVSQ
GPEELVASLQTSVVAPGEAPSEDADHEGKGSPLKMPKIKLPSFRWSPKKETGPKVDPECS
VEDSKLSLVLDKDEVAPQSAIHMDLPPERDGEKGRSTKPGFAMPKLALPKMKASKSGVSL
PQRDVDPSLSSATAGGSFQDTEKASSDGGRGGLGATASATGSEGVNLHRPQVHIPSLGFA
KPDLRSSKAKVEVSQPEADLPLPKHDLSTEGDSRGCGLGDVPVSQPCGEGIAPTPEDPLQ
PSCRKPDAEVLTVESPEEEAMTKYSQESWFKMPKFRMPSLRRSFRDRGGAGKLEVAQTQA
PAATGGEAAAKVKEFLVSGSNVEAAMSLQLPEADAEVTASESKSSTDILRCDLDSTGLKL
HLSTAGMTGDELSTSEVRIHPSKGPLPFQMPGMRLPETQVLPGEIDETPLSKPGHDLASM
EDKTEKWSSQPEGPLKLKASSTDMPSQISVVNVDQLWEDSVLTVKFPKLMVPRFSFPAPS
SEDDVFIPTVREVQCPEANIDTALCKESPGLWGASILKAGAGVPGEQPVDLNLPLEAPPI
SKVRVHIQGAQVESQEVTIHSIVTPEFVDLSVPRTFSTQIVRESEIPTSEIQTPSYGFSL
LKVKIPEPHTQARVYTTMTQHSRTQEGTEEAPIQATPGVDSISGDLQPDTGEPFEMISSS
VNVLGQQTLTFEVPSGHQLADSCSDEEPAEILEFPPDDSQEATTPLADEGRAPKDKPESK
KSGLLWFWLPNIGFSSSVDETGVDSKNDVQRSAPIQTQPEARPEAELPKKQEKAGWFRFP
KLGFSSSPTKKSKSTEDGAELEEQKLQEETITFFDARESFSPEEKEEGELIGPVGTGLDS
RVMVTSAARTELILPEQDRKADDESKGSGLGPNEG
NT seq 17388 nt   +upstreamnt  +downstreamnt
atgtgcgactgcttccacatggtgctgcccacctggcccggaacccccggcagcgtgtcc
ggccgtcagctgcagcccggggagccaggtgcagaaacggaagatgaccactctgtgact
gaagggcctgcggatgagggcattcgaccacggccgcaggggtcttcacctgtctacgaa
tacacgactgaggctgccgactttggactccaggaagacgcccccggcaggcaaggttct
gctgggagacggagatcctggtggaagcgagattcaggggactcacggacatttttcagg
atgagtcgtccagaggctgtccaggaggcaacagaggtgacgctgaagacagaggtggag
gcaggagccagtggctacagtgtcacaggtggtggggaccaggggatcttcgtcaagcaa
gtgctgaaggactcctcagccgccaagctttttaacttgagagaaggggatcagctgctc
agtacaaccgtgttctttgaaaacataaaatatgaagatgctctcaaaatccttcaatat
tcagagccgtacaaggttcagttcaaaatcagacggcagctccctgccccacaggatgaa
gagtgggcttccagcgatgcccagcacggcccacagggcaaggagaaggaggacacggat
gttgctgatgggtgcagagagacccccacgaaaactctggaaggagatggggaccaagag
agactcatctccaaaccaagggtggggagaggcaggcagagccagagggagaggctctct
tggccaaaatttcaatccataaagagcaagcgggggccgggaccccagaggtcacacagc
tcgtcagaggcctacgaacctagggacgcacatgacgtgtcccctacaagcacagacaca
gaggcccagctcacggtggagcgccaagagcagaaggcagggccgggcagccagaggagg
cggaagttcctcaacctcagattcaggacaggctcgggacagggcccttcatcgacagga
cagccaggcagggggttccagagtggggtgggccgtgctggggtcctggaagagttgggg
ccctggggtgatagcctcgaggagactggggctgccacaggcagcaggagagaggagagg
gcagaacaggatcgagaagtgatgcctgctcagagcatgccattgcccacagagctcggt
gaccctagactttgcgagggaacccctcaggaagggggactcagggcagccaggctccat
ggaaagaccctggaggggcaggcacaggagacagcagtggcccagaggaagcccagggcc
cagccaactcctggaatgagccgggagggtgaaggcgagggactgcagagcctggaaatc
gggatcgccagactgtccttgagagacacaaccgaaggaggcacacagattggcccacca
gaaattagggtgcgagtacacgatttaaagacaccaaaatttgcattttccacagaaaaa
gagccagaaagagaaaggcgccttagtaccccacagcgagggaagagacaggatgcgtcc
tcaaaagcgggtactggcctgaagggtgaggaggtggaaggagccgggtggatgccgggc
agggaaccaaccacacatgcagaagcacagggggatgaaggagatggagaggaaggacta
cagaggacaaggatcactgaggaacaggacaagggcagggaagacacagaaggacagata
agaatgcccaagttcaagataccctccttaggatggtcgccaagcaagcacacaaagaca
ggcagagaaaaagccacagaagacacagagcagggaagggaaggagaggccacagcaaca
gctgatagaagagaacagagacgcacagaggaaggattaaaagacaaagaagacagtgac
tcaatgacaaacacaacaaaaatacaactaatacacgatgaaaaacgcttaaaaaaggaa
caaattctgacagaaaaggaagtggccaccaaagacagcaagttcaaaatgcccaagttc
aagatgccattgttcggggcgtcagccccaggcaagtccatggaggcctcggtggatgtg
tctgcgccgaaggtggaggccgacgtgagcctcctctccatgcagggggacctcaagacc
actgacctcagcgtccagaccccttccgctgacctggaggtccaggatggccaagtggat
gtgaaacttccggagggccccctgcccgagggagccagcctcaaagggcacctgcccaag
gtgcagaggcccagtttgaagatgcccaaagtggacctcaagggccccaagctggacctg
aaaggccccaaggcggaagtgacagcccccgatgtgaagatgtctctgtccagcatggag
gtggacgtccaggccccgagagcaaagctggatggtgcgcggctggagggggacctgtcc
ctggccgacaaggaggtgactgccaaagacagcaagttcaaaatgcccaagttcaagatg
ccatcattcggggtgtcggccccaggcaagtccatggaggactcggtggatgtgtctgcg
ccgaaggtggaggccgacgtgagcctctcctccatgcagggggacctcaaggccactgac
ctcagcattcagcccccttccgctgacctggaggtccaggctggccaagtggatgtgaaa
cttccggagggccctgtgcccgagggagccggccccaaagtgcacctgcccaaagtggag
atgcccagtttcaagatgcccaaagtggacctcaagggcccccagatagatgttaagggc
cccaagctggacctgaaaggccccaaggcggaagtgacagcccccgatggcgaggtgtct
ctgcccagcatggaggtggatgtccaggcccagaaggccaagctggatggtgcgtggctg
gagggggacctgtccctggccgacaaggacgtgactgccaaagacagcaagttcaaaatg
cccaagttcaagatgccgtcgttcggggtatcggccccagggaagtccatcaaggccttg
gtggatgtgtctgcacccaaggtggaggccgacctgagtctcccctccatgcagggggac
ctgaagaccactgacctcagcattcagcctgcttctactgacctgaaggtccaggctgac
caggtggatgtgaagctcccggagggccacctgcccgagggagctggccttaaagggcac
ttgcccaaggtggagatgcccagtttcaagatgcccaaagtggccctcaagggcccccag
gtggacgtcaagggccccaagctggacctgaaaagccccaaggcggaagtcacagcccct
gatgtggaggtgtctctgcccagcgtggaggtggacgtcgaggccccgggagccaagctg
gacagtgcgcggctggagggggaactgtccctggccgacaaggatgtgactgccaaagac
agcaggttcaaaatgcccaagttcaagatgccatcgttcggggcgtcagccccaggcaag
tccatcgaggcctcggtggatgtgtctgcacccaaagtggaggccgacgtgagtctcccc
tccatgcagggggacctcaagaccactgacctcagcattcagcccccttccgctgacctg
gaggtccacgctggccaggtggacgtgaagctcctggagggccacgtgcctgagggagcc
ggcttcaaagggcacctgcccaaggtgcagatgcctagtttgaagatgcccaaagtggac
ctcaagggcccccaggtggaagtcaggggccccaagctggacctgaaaggtcataaggca
gaggtgacggcccacgaagtggctgtgtctctgcccagtgtggaggtggacatgcaggcc
ccgggagccaagttggatggcgcacagctggacggggacctgtccctggctgacaaggac
gtgactgccaaagacagcaagttcaaaatgcccaagttcaagatgccgtcgttcggggtg
tctgccccaggcaagtccattgaggcctccgtggacctgtctgcacccaaggtggaggcc
gacatgagcctcccctccatgcagggggacctcaagaccactgacctcagcattcagccc
ccttccactgacctggagctccaggctggccaattggacgtgaaactcccagagggcccc
gtgcccgagggagccggcctcaaagggcacctgcccaagctgcagatgcccagtttcaag
gtgcccaaagtggacctcaagggccctgaaatagacatcaagggccccaagctggaccta
aaagaccccaaggtggaagtgacagcccctgatgtggaggtttctctgcccagcgtggag
gtggatgtcgaggccccaggagccaagctggatggtggacggctggaggaggacatgtcc
ctggccgacaaggacttgactaccaaagacagcaagttcaaaatgcccaagttcaagatg
ccgtcgttcggggtgtctgccccaggcaagtccatcgaggcctcagtggatgtgtctgcg
ccgaaggtggaggccgacgtgagcctcccctccatgcagggggacctcaaggccactgac
ctgagcatacagcccccttctgctgacctggaggtccaggctggccaagtggacgtgaaa
ctcccagagggccctgtgtccgagggagccggcctcaaagggcacctgcccaaagtgcag
atgcccagtttcaagatgcccaaagtggacctcaaggggccccagatagatgttaagggc
cccaagctggacctgaaaggccccaaggtggaagtgacagcccccgatgtgaagatgtct
ctgtccagcatggaggtggacgtccaggccccgagagcaaagctggatggtgcgcagctg
gagggggacctgtccctggccgacaaggcggtgactgccaaagacagcaagttcaaaatg
cccaagttcaagatgccatcatttggggtgtcggccccaggcaagtccatcgaggcctcg
gtggatgtgtctgagccgaaggtggaagctgatgtgagcctcccctccatgcagggggac
ctgaagaccactgacctcagcattcagtccccttccgccgacctggaggtccaggctggc
caagtgaacgtgaaactcccggagggcccccttcccgagggagccggcttcaaagggcac
ctccccaaggtgcagatgcccagtttgaagatgcccaaagtggccctcaagggcccccag
atggacgtcaagggccccaagctggacctgaaaggccccaaggcggaggtgatggccccc
gacgtggaggtgtctctgcccagcgtggaggtggacgtcgaggctccaggagccaagctg
gacagtgtgcggctggagggtgacctgtccctggccgacaaggatgtgactgccaaagac
agcaagttcaaaatgcccaagttcaagatgccgtcgttcggggtgtctgccccaggcaag
tccatcgaggcctcggtggatgtgtctgcgccgaaggtggaggccgaagtgagcctcccc
tccatgcagggggacctcaagaccacggacctctgcattccgctcccttctgcagacctg
gtggtccaggctggccaagtggacatgaagctcccggagggccaggtgcccgagggagcc
ggcctcaaagggcacttgcccaaggtggatatgcccagtttcaagatgcccaaagtggac
ctcaagggcccccagacagatgttaagggcgccaagctggacctgaaaggccccaaggcg
gaagtgacagcccccgatgtcgaggtgtctctgcccagcatggaggtggatgtccaggcc
cagaaggctaagctggatggtgcgcggctggagggagacctgtccctggccgacaaggac
atgactgccaaagacagcaagttcaaaatgcccaaattcaagatgccgtcgttcggggta
tcggccccagggaggtccatcgaggcctcggtggatgtgcctgcacccaaggtggaggcc
gacgtgagtctcccctccatgcagggggacctgaagaccactgacctcagcattcagccc
ccttctgccgacctgaaggtccagactggccaggtggatgtgaagctcccggagggccac
gtgcccgagggagctggcctcaaagggcacctgcccaaggtggagatgcccagtttgaag
atgcccaaagtggacctcaagggcccccaggtggacatcaagggccccaaactggaccta
aaagaccccaaggtggaaatgagagtccccgatgtcgaggtgtctctgcccagcatggag
gtggacgtccaggccccaagagccaagctggatagtgcgcatctgcagggggacctgacc
ctggccaacaaggacctgactaccaaagacagcaagttcaaaatgcccaagttcaagatg
ccgtcgtttggggtgtctgccccaggcaagtccatcgaggcctcggtggatgtgtctcca
cccaaggtggaggccgacatgagtctcccctccatgcagggggacctcaagaccactgac
ctcagcattcagcccctttccgccgacgtgaaggtccaggctggccaggtggacgtgaaa
ctcctggagggccctgtgcccgaggaagtcggcctcaaagggcacctgcccaagctgcag
atgcccagtttcaaggtgcccaaagtggacctcaagggccccgaaatagacatcaagggc
cccaagctggacctaaaagaccccaaggtggaagtgacagcccctgatgtggaggtgtct
ctgcccagcgtggaggtggacgtcaaggccccaggagccaagctggatggtgcgcggctg
gagggggacatgtccctggccgacaaggacgtgactgccaaagacagcaagttcaaaatg
cccaagttcaagatgctgtcgtttggggtgtctgcccttggcaagtccatcgaggcctca
gcggatgtgtctgcgttgaaggtggaggccgacgtgagcctcccctccatgcagggggac
ctcaagaccactgacctcagcgttcagcccccttccgctgacctggaggtccaggctggc
caagtggatgtgaaactcccagagggccccgtgccggagggagccggcctcaaagggcac
ctgcccaagctgcagatgcccagtttcaagatgcccaaagtagatctcaagggcccccag
atagatgtcaagggccccaagctggacctgaaaggccccaagacggacgtgatggccccc
gacgtggaggtgtctcagcccagcgtggaggtggatgtcgaggccccgggagccaagctg
gatggtgcgtggctggagggggacctgtctgtggcggacaaggatgtgactaccaaagac
agcaggttcaaaattcccaagttcaagatgccgtcattcggggtgtctgccccaggcaag
tccatcgaggcctcggtggatgtgtctgcgccgaaggtggaggccgacgggagcctctcc
tccatgcagggggacctcaaggccactgacctcagcattcagcccccttccgctgacctg
gaggtccaggctggccaagtggacgtgaaactcccagagggccctgtgccggagggagcc
ggcctcaaagggcacctgcccaaggtgcagatgcccagtttcaagatgcctgaaatggac
ctcaagggcccccagctagatgtcaagggccccaagctggacctgaaaggccccaaggcg
gaagtgacagcccccgatgtggagatgtctctgtccagcatggaggtggacgtccaggcc
ccgagagcaaagctggatggtgcgcggctggagggggacctgtccctggccgacaagggt
gtgacagccaaagatagcaagttcaaaatgcccaagttcaagatgccatcattcagggtg
tcggccccaggcgagtccatcgaggcgttggtggatgtgtctgagctgaaggtggaagcc
gacatgagcctcccctccatgcaaggggaccttaagaccactgacatcagcattcagccc
ccctctgcccaactggaggtccaggctggccaggtggatgtgaaactcccagagggccac
gttcccgagggagccggcctcaaagggcacctgcccaagctgcagatgcccagtttcaag
atgcctgaagtggacctcaagggcccccagatagatgttaagggccccaacgtggacctg
aaaggccccaaggcggaagtgacagcccccgatgtgaagatgtctctgtccagcatggag
gtggacgtccaggccccgagagcaaagctggatggtgcgcggctggagggggacctgtcc
ctggccgacaagggcatgacagccaaagacagcaagttcaaaatgcccaagttcaagatg
ccgtcattcggggtgtcggccccaggcaagtccatcgaggcctcggtggatgtgtctgag
ctgaaggtggaagctgacgggagcttcccctccatgcaaggggatcttaagaccactgac
atccgcattcagcccccctccgcccaactggaggtccaggctggccaggtggacgtgaaa
ctcccagagggccacgttcccgagggagccggcctcaaagggcacctgcccaaggtgcag
atgcccagtttcaagatgcccaaagtggatctcaagggcccccagatagacgtcaagggc
cccaagctggacctgaaaggccccaaggcggaggtgacggcccccgacgtggaggtgtct
ctgcccagcgtggaggtggacgtcgaggccccgagagcaaagctggatggtgcacggctg
gagggtgacctgtccctggccgacaaggatgtgactgccaaagacagcaagttcaaaatg
cccaagttcaagatgccgtcgttcggggtgtctgccccaggcaagtccattgaggtctcg
gtggatgtgtctgcgccgaaggtggaggccgaagtgagcctcccctccatgcagggggac
ctgaagaccactgacatcagcattgagcccccctctgcccaactggaggtccaggctggc
caggtggacctgaagctcccagagggccacgttcccgagggagctggcctcaaagggcac
ctgcccaagttgcagatgcccagtttcaagatgcccaaagtagatcgcaagggaccccag
atagatgtcaagggccccaagctggacctgaaaggcccgaagacggacgtgacggccccc
gacgtggaggtgtctcagcccggcatggaggtggatgtcgaggccccaggagccaagttg
gatggtgcacggctggagggggacctgtccctggccgacaaggatgtgactgccaaagac
agcaagttcaaaatgcccaagttcaagatgccgtcgttcggggtgtctgccccaggcaag
tccattgaggtcttggtggatgtgtctgcgccaaaggtggaggccgacctgagcctcccc
tccatgcagggggacctgaagaacactgacatcagcattgagcccccctctgcccaactg
gaggtccaggctggccaggtggacgtgaagctcccagagggccacgttctcgagggagct
ggcctcaaagggcacctgcccaagttgcagatgcccagtttcaagatgcccaaagtagat
cgcaagggcccccagatagacatcaagggccccaagctggacctgaaaggcccgaagatg
gatgtgacggcccccgacgtggaggtgtctcagcccagcatggaggtggacgtcgaggcc
ccaggagccaagttggatggtgcacggctggagggggacctgtccctggccgacaaggat
gtgactgccaaagacagcaagttcaaaatgcccaaattcaagatgccgtcgtacagggcg
tctgccccaggcaagtccatccaggcctcggtggatgtgtctgcgccgaaggcggaggcc
gacgtgagcctcccctccatgcagggggacctcaagaccactgacctcagcattcagctc
ccttctgtggacctggaggtccaggctggccaggtggacgtgaagctcccggagggccac
gtgcccgagggagctggcctcaaagggcacctgcccaaggtggagatgcccagtttcaag
atgcccaaagtggacctcaagagcccccaggtggacatcaagggccccaagctggaccta
aaagtccccaaggcggaagtgacagtccctgatgtggaggtgtctctgcccagcgtggag
gtggacgtccaggccccgagagccaagctggatggtgcgcggctggagggggacctgtcc
ctggctgaaaaggatgtgactgccaaagacagcaagttcaaaatgcccaagttcaagatg
ccctccttcggggtgtcggccccaggcaggtccatcgaggcctcgctggatgtgtctgcg
ccgaaggtggaggccgacgtgagcctctcctccatgcagggggacctcaaggccactgac
ctcagcattcagcccccttccgctgacctggaggtccaggctgtccaagtggatgtggaa
ctcctggagggccccgtgcccgagggagccggcctcaaagggcacctgcccaaagtggag
atgcccagtttaaagacgcccaaagtggacctcaagggcccccagatagatgttaagggc
cccaagctggacctgaaaggccccaaggcagaagtgagagtccccgatgtcgaggtgtct
ctgcccagcgtggaggtggatgtccaggccccgaaggccaagctggatgctgggcggctg
gagggagacctgtccctggctgacaaggacgtgactgccaaagacagcaagttcaaaatg
cccaaattcaagatgccgtcattcagggtatcggccccagggaagtccatggaggcctcg
gtggatgtgtctgcacccaaggtggaagccgatgtgagtctcccctccatgcagggggac
ctgaagaccactgacctcagcattcagcccccttctgccgacctgaaggtccaggctggc
cagatggatgtgaagctcccggagggccaggtgcccgagggagccggcctcaaagagcac
ctgcccaaggtggagatgcccagtttgaagatgcccaaagtggacctcaagggcccccag
gtggacatcaagggccccaagctggacctaaaagtctccaaggcggaagtcacagcccct
gatgtggaggtgtctctgcccagcgtggaggtggacgtccaggccccaagagccaaactg
gatagtgcacagctggagggggacctgtccctggccgacaaggatgtgactgccaaagac
agcaaattcaaaatgcccaagttcaagatgccgtcatttggggtgtctgccccaggcaag
tccattgaggcctcggtgcacgtgtctgcacccaaggtggaggccgatgtgagtctcccc
tccatgcagggggacctcaagaccactgacctcagcattcagccccattctgccgacctg
acggtccaagctcgccaggtggacatgaaactcctggagggccacgtgcccgaggaagcc
ggcctcaaaggacacctgcccaaggtgcagatgcccagtttcaagatgcccaaagtcgac
ctcaagggccctgaaatagacatcaagggccccaagctggacctaaaagaccccaaggtg
gaagtgacagcccctgatgtggaggtttctctgcccagcgtggaggtggacgtcgaggcc
ccaggagccaagctggatggtgcgcggctggagggggacctgtccctggccgacaaggac
atgacggccaaagacagcaagttcaaaatgcccaagttcaagatgccgtcgttcggggtg
tctgccccaggcaagtccatggaggcatcagtggatgtgaccgcgccaaaggtggaggcc
gacgtgagcctcccttccatgcagggggacctcaaggccactgacctcagcgttcagccc
ccttccgctgacctggaggtccaggctggccaagtggacgtgaaactcccagagggcccc
gtgcccgagggagccagcctcaaagggcacctgcccaaggtgcagatgcccagtttcaag
atgcccaaagtggacctcaagggcccccagatagatgttaagggccccaagctggacctg
aaaggccccaaggcggaagtgacagcccctgatgtgaagatgtctctgtccagcatggag
gtggacgtccaggccccgagagcaaagctggatggtgtgcagctggagggggacctgtcc
ctggccgacaaggatgtgactgccaaagacagcaagttcaaaatgcccaagttcaagatg
ccatcattcggggtgtcggccccaggcaagtccatggaggcgtccgtggatgtgtctgag
ctgaaggcgaaagccgacgtgagcctcccctccatgcagggggacctcaagaccactgac
ctcagcattcagtccccttccgccgacctggaggtccaggctggccaagtggacgtgaaa
ctcccggagggccccctgcccaagggagccggcctcaaagggcacctccccaaggtgcag
atgccctgtttgaagatgcccaaagtggccctcaagggcccccaggtggatgtcaagggc
cccaagctggacctgaaaggccccaaggcggatgtgatgacccccgtcgtggaggtgtct
ctgcccagcatggaggtggacgtcgaggccccgggagccaagctggacagtgtgcggctg
gagggtgacctgtccctagccgacaaggacatgactgccaaagacagcaagttcaaaatg
cccaagttcaagatgccgtcgttcggggtgtctgccccaggcaagtccatcgaggcctcg
ttggatgtgtctgcgctgaaggtggaggctgacgtgagcctcccctccatgcagggggac
ctgaagaccactcacctcagcattcagcccccttccgctgatctggaggtccaggctggc
caagaggatgtgaaactcccagagggccctgtgcatgagggagccggcctcaaagggcac
ctgccgaagctgcagatgcccagtttcaaggtacccaaagtggacctcaagggtccccag
atagacgttaatgtccccaagctggacctgaaaggccccaaggtggaggtgacgtccccc
aacctggacgtgtctctgcccagcatggaggtggacatccaagccccaggagccaagctg
gacagtacgcggctggagggggacctgtccctggctgacaaggacgtgactgccaaagac
agcaagttcaaaatgcccaagttcaagatgccatcctttgggatgttgtccccaggcaag
tccatcgaggtctcggtggatgtgtctgcgccaaagatggaggccgacatgagcattccc
tccatgcagggggacctcaagaccactgacctccgcattcaggccccttccgccgacctg
gaggtccaggctggccaggtggacttgaaacttccagaaggccacatgcccgaggtagcc
ggcctcaaagggcacctgcccaaggtggagatgcccagtttcaagatgcccaaagtggac
ctcaagggcccccaggtggacgtcaagggccccaagctggacctgaaaggcccaaaggca
gaggtgatggcccccgatgtggaggtgtctctgcccagcgtggagacggatgtccaggcc
ccaggatccatgctggatggtgcgcggcttgagggggacctgtccctggcccacgaggat
gtagctgggaaagacagtaagtttcaaggaccaaaactgagcacgtctggttttgaatgg
tcgtcaaagaaagtttccatgtcttcctctgaaatcgaaggaaatgttacattccatgag
aagacttccacatttcccattgtggaatctgttgttcatgaaggtgatcttcatgatcca
tctcgcgatggtaacttggggcttgctgttggagaagttggaatggattcgaagtttaag
aaactgcattttaaagtgcccaaagtttcattttcttctaccaaaactcctaaagatagt
ttagtcccaggtgcaaagtctagcataggtctttccacgattcctttatcatcttcagaa
tgctcaagttttgaattacaacaggtttcggcttgttcagagccatccatgcagatgcct
aaggtgggttttgctgggtttccatcatcccggcttgatctcactggtcctcactttgaa
tcttctattctctctccctgtgaggatgttacacttacaaaataccaggtgactgttccc
agagctgccttggcccctgagcttgctctggaaattccttctgggtctcaggctgatatt
cctcttcccaagacagagtgctccactgacctgcagcctccagagggagttccaacatct
caagctgagagtcactctggcccactgaattccatgattcctgtttctcttggtcaggta
tcttttcctaaattctataaaccaaagtttgtgttttcagtcccccaaatggcagttcct
gagggagacctacatgcagcagtgggtgccccagtcatgtctcctcttagccctggagaa
agagtgcagtgccccttgccaagcacccagctgccatccccaggcacctgtgtgtctcag
ggcccagaagagcttgtggcctccttgcagacatcagtagtggcccctggagaagcccct
tctgaagatgctgaccacgaagggaaagggagtcccttgaaaatgcctaagattaagctt
ccatcatttaggtggtccccgaagaaggaaacagggccaaaggtggacccagaatgcagc
gtggaggactcaaaactcagcctggttttagacaaggatgaagtggccccgcagtctgcc
atccacatggatctgcctcctgagagggatggagagaaggggaggagcacaaagcctggc
tttgccatgccaaaacttgcacttcccaaaatgaaggcttctaagagtggggtcagcctg
ccacagagagacgtggatccttccctttctagtgccacagcagggggtagctttcaagac
acagaaaaggccagcagtgacggtggtaggggaggacttggtgcaacagcaagtgccaca
ggaagtgagggtgtgaacctccaccggccacaggtccacattcccagtttgggctttgcc
aaacctgatctcagatcctccaaggccaaggtggaggtgagccagcctgaagctgacctg
cctcttcccaaacatgatctgtctaccgaaggtgacagcagaggatgtgggctcggggat
gtcccagtgagccagccttgtggggaggggatagcccccacacctgaagatcccctccag
ccatcctgtagaaaaccagatgctgaagtcctcacagtggaaagcccagaggaggaagcc
atgaccaagtactcgcaggaaagctggtttaaaatgcccaagttccgcatgcccagcctt
aggcgctctttcagggacagaggcggggctggaaagctggaagtggctcagacacaggca
ccggcagcaacagggggtgaagcagcagctaaagtcaaagagttccttgtttctgggtca
aacgtggaggcagctatgtccctacagctcccagaggcagatgcagaagtgacagcttct
gagagcaaatcatccacagatattctaaggtgtgatcttgacagcacaggcttgaagctg
cacctctccactgctgggatgactggggatgagctttccacttctgaggtcaggatccat
ccatccaaaggacctctcccttttcagatgcctggcatgaggcttccagaaacccaggtt
cttccaggagaaatagatgagactcctctttccaagccaggacatgaccttgccagcatg
gaggataaaacagagaaatggtcttcccagcctgaaggtccacttaaattgaaagcttca
agtactgatatgccatcccagatttctgtggttaatgtggatcaactgtgggaagattct
gtcctaactgtcaaattccccaaattaatggtaccaaggttctccttccctgcccccagc
tcagaggatgatgtgttcatccccactgtgagggaagtgcagtgtccagaggccaatatt
gatacagccctttgtaaggaaagtccggggctctggggagccagcatcctgaaggcaggt
gctggggtccctggggagcagcctgtggaccttaacctgcctttggaagctcccccaatt
tcaaaggtcagagtgcatattcagggtgctcaggttgaaagtcaagaggtcactatacac
agcatagtgacaccagagtttgtagatctctcagtacccaggactttttccactcagatt
gtgcgggaatcagagatccccacgtcagagattcaaacaccttcgtacggattttcctta
ttaaaagtgaaaatcccagagccccacacgcaggctagagtgtacacaacaatgactcaa
cactctaggactcaggagggcacagaagaggctcccatacaagccaccccaggagtagac
tccatttctggagatctccagcctgacactggagaaccatttgagatgatctcttccagc
gtcaatgtactgggacagcaaacactcacatttgaagttccttctggccaccagcttgca
gacagctgttcagatgaggagccagcagaaattcttgagtttccccctgatgatagccaa
gaggcaaccacaccactggcagatgaaggcagggctccaaaagacaaaccagaaagtaaa
aaatctggtctgctctggttttggcttccaaacattgggttttcctcttctgttgatgag
acaggtgttgattccaaaaatgacgtccagagatctgctcccattcaaacacagcctgag
gcacgaccagaggcagaactgcctaaaaaacaggagaaggcaggctggttccgatttccc
aaattagggttctcctcatctcctaccaagaaaagcaaaagcaccgaagatggggcagag
ctggaagaacaaaaacttcaagaagaaacaatcacgttttttgatgcccgagaaagtttc
tcccctgaagagaaggaagagggtgaactgatcgggcctgtgggcactgggctggactcc
agagtgatggtgacatccgcggcaagaacagagttaatcctgcccgagcaggacagaaaa
gctgacgatgaaagcaaagggtcaggcctgggaccaaatgaaggctga

DBGET integrated database retrieval system