KEGG   Homo sapiens (human): 11317Help
Entry
11317             CDS       T01001                                 

Gene name
RBPJL, RBPL, RBPSUHL, SUHL
Definition
(RefSeq) recombination signal binding protein for immunoglobulin kappa J region like
  KO
K06053  recombining binding protein suppressor of hairless
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
nt06116  NOTCH signaling (virus)
nt06166  Human papillomavirus (HPV)
  Element
N00380  HPV E6 to Notch signaling pathway
N00381  HPV E6 to Notch signaling pathway
N00382  HPV E6 to Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    11317 (RBPJL)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    11317 (RBPJL)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    11317 (RBPJL)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    11317 (RBPJL)
   05165 Human papillomavirus infection
    11317 (RBPJL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    11317 (RBPJL)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Other transcription factors
   Others
    11317 (RBPJL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTD LAG1-DNAbind
Motif
Other DBs
NCBI-GeneID: 11317
NCBI-ProteinID: NP_055091
OMIM: 616104
HGNC: 13761
Ensembl: ENSG00000124232
Vega: OTTHUMG00000033055
Pharos: Q9UBG7(Tbio)
UniProt: Q9UBG7
LinkDB All DBs
Position
20q13.12
AA seq 517 aa AA seqDB search
MDPAGAADPSVPPNPLTHLSLQDRSEMQLQSEADRRSLPGTWTRSSPEHTTILRGGVRRC
LQQQCEQTVRILHAKVAQKSYGNEKRFFCPPPCVYLSGPGWRVKPGQDQAHQAGETGPTV
CGYMGLDSASGSATETQKLNFEQQPDSREFGCAKTLYISDADKRKHFRLVLRLVLRGGRE
LGTFHSRLIKVISKPSQKKQSLKNTDLCISSGSKVSLFNRLRSQTVSTRYLSVEDGAFVA
SARQWAAFTLHLADGHSAQGDFPPREGYVRYGSLVQLVCTVTGITLPPMIIRKVAKQCAL
LDVDEPISQLHKCAFQFPGSPPGGGGTYLCLATEKVVQFQASPCPKEANRALLNDSSCWT
IIGTESVEFSFSTSLACTLEPVTPVPLISTLELSGGGDVATLELHGENFHAGLKVWFGDV
EAETMYRSPRSLVCVVPDVAAFCSDWRWLRAPITIPMSLVRADGLFYPSAFSFTYTPEYS
VRPGHPGVPEPATDADALLESIHQEFTRTNFHLFIQT
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggaccccgcaggggcagcagacccctcagtgcctcccaatcctttgactcacctgagc
ctgcaggacagatcagagatgcagctgcagagcgaagccgacaggcggagcctcccgggc
acttggaccaggtcatccccagagcacaccaccattctgaggggaggcgtgcgcaggtgc
ctgcagcaacagtgtgaacagactgtgcggatcctgcatgccaaggtggcccagaaatca
tacggaaatgagaagcggttcttctgccccccgccctgtgtctacctctcggggcctggc
tggagggtgaagccagggcaggatcaagctcaccaggcgggggaaacggggcccacggtc
tgcggttacatgggactggacagcgcgtccggcagcgccactgagacgcagaagctgaat
ttcgagcagcagccggactccagggaattcggctgcgccaagaccctgtacatctcagat
gcagacaagaggaagcactttcggctggtgctgcggctggtgctgcgcgggggccgggag
ctgggtaccttccacagccgccttatcaaggtcatctcgaagccctcgcagaagaagcag
tcgctgaaaaacaccgatctgtgcatatcctccggctcaaaggtctccctcttcaaccgc
ctgcgctctcagacggtctccacacgctacctctctgtggaggatggggcctttgtggcc
agtgcacgacagtgggctgccttcacgctccacctggctgatgggcactctgcccaagga
gacttcccaccgcgagagggctacgttcgctatggctccctggtgcagctcgtctgcacg
gtcaccggcatcacactacctcccatgatcatccgtaaagtagcaaaacagtgtgcgctc
cttgatgtggatgagcccatctcccagctgcacaagtgtgcattccagtttccaggcagt
cccccaggagggggtggcacctacttatgccttgccacagagaaggtggtgcaatttcag
gcctctccctgccccaaggaggcgaacagggctctgcttaacgacagctcttgctggacc
atcatcggcaccgagtcggtggaattttccttcagcaccagcctggcgtgtaccctggag
ccggtcactccggtgcctctcatcagcaccctagagctgagcggcgggggcgacgtggcc
acgctggagctccacggagagaacttccacgcggggctcaaggtgtggtttggggacgtg
gaggcagaaaccatgtacaggagcccgcggtccctggtgtgcgtggtgccggacgtggcg
gccttctgcagcgactggcgctggctgcgcgctcccatcacaatccccatgagcctggtg
cgcgccgacgggctcttctaccctagtgccttctccttcacctacaccccggaatacagc
gtgcggccgggtcaccccggcgtccccgagcccgccaccgacgccgacgcgctcctggag
agcatccatcaggagttcacgcgcaccaacttccacctcttcatccagacttag

KEGG   Homo sapiens (human): 3516Help
Entry
3516              CDS       T01001                                 

Gene name
RBPJ, AOS3, CBF1, IGKJRB, IGKJRB1, KBF2, RBP-J, RBPJK, RBPSUH, SUH, csl
Definition
(RefSeq) recombination signal binding protein for immunoglobulin kappa J region
  KO
K06053  recombining binding protein suppressor of hairless
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
nt06116  NOTCH signaling (virus)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
  Element
N00224  EBV EBNALP RBP-Jk-mediated transcription
N00225  EBV EBNA2 to RBP-Jk-mediated transcription
N00226  EBV EBNA3A/3B/3C to RBP-Jk-mediated transcription
N00380  HPV E6 to Notch signaling pathway
N00381  HPV E6 to Notch signaling pathway
N00382  HPV E6 to Notch signaling pathway
Disease
H01413  Adams-Oliver syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    3516 (RBPJ)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    3516 (RBPJ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3516 (RBPJ)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    3516 (RBPJ)
   05165 Human papillomavirus infection
    3516 (RBPJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3516 (RBPJ)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Other transcription factors
   Others
    3516 (RBPJ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTD LAG1-DNAbind TIG RHD_dimer
Motif
Other DBs
NCBI-GeneID: 3516
NCBI-ProteinID: NP_005340
OMIM: 147183
HGNC: 5724
Ensembl: ENSG00000168214
Vega: OTTHUMG00000097793
Pharos: Q06330(Tbio)
UniProt: Q06330
LinkDB All DBs
Structure
PDB: 

Position
4p15.2
AA seq 500 aa AA seqDB search
MDHTEGSPAEEPPAHAPSPGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSY
GNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGK
NYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLC
IASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDG
YIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCL
SQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESL
QLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQ
PVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGS
YTNASTNSTSVTSSTATVVS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggaccacacggagggctcgcccgcggaggagccgcctgcgcatgctccatcgcctggg
aaatttggtgagcggcctccacctaaacgacttactagggaagctatgcgaaattattta
aaagagcgaggggatcaaacagtacttattcttcatgcaaaagttgcacagaagtcatat
ggaaatgaaaaaaggtttttttgcccacctccttgtgtatatcttatgggcagtggatgg
aagaaaaaaaaagaacaaatggaacgcgatggttgttctgaacaagagtctcaaccgtgt
gcatttattgggataggaaatagtgaccaagaaatgcagcagctaaacttggaaggaaag
aactattgcacagccaaaacattgtatatatctgactcagacaagcgaaagcacttcatg
ttgtctgtaaagatgttctatggcaacagtgatgacattggtgtgttcctcagcaagcgg
ataaaagtcatctccaaaccttccaaaaagaagcagtcattgaaaaatgctgacttatgc
attgcctcaggaacaaaggtggctctgtttaatcgactacgatcccagacagttagtacc
agatacttgcatgtagaaggaggtaattttcatgccagttcacagcagtggggagccttt
tttattcatctcttggatgatgatgaatcagaaggagaagaattcacagtccgagatggc
tacatccattatggacaaacagtcaaacttgtgtgctcagttactggcatggcactccca
agattgataattaggaaagttgataagcagaccgcattattggatgcagatgatcctgtg
tcacaactccataaatgtgcattttaccttaaggatacagaaagaatgtatttgtgcctt
tctcaagaaagaataattcaatttcaggccactccatgtccaaaagaaccaaataaagag
atgataaatgatggcgcttcctggacaatcattagcacagataaggcagagtatacattt
tatgagggaatgggccctgtccttgccccagtcactcctgtgcctgtggtagagagcctt
cagttgaatggcggtggggacgtagcaatgcttgaacttacaggacagaatttcactcca
aatttacgagtgtggtttggggatgtagaagctgaaactatgtacaggtgtggagagagt
atgctctgtgtcgtcccagacatttctgcattccgagaaggttggagatgggtccggcaa
ccagtccaggttccagtaactttggtccgaaatgatggaatcatttattccaccagcctt
acctttacctacacaccagaaccagggccgcggccacattgcagtgcagcaggagcaatc
cttcgagccaattcaagccaggtgccccctaacgaatcaaacacaaacagcgagggaagt
tacacaaacgccagcacaaattcaaccagtgtcacatcatctacagccacagtggtatcc
taa

DBGET integrated database retrieval system