KEGG   Homo sapiens (human): 11337Help
Entry
11337             CDS       T01001                                 

Gene name
GABARAP, ATG8A, GABARAP-a, MM46
Definition
(RefSeq) GABA type A receptor-associated protein
  KO
K08341  GABA(A) receptor-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04136  Autophagy - other
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04371  Apelin signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04727  GABAergic synapse
hsa05131  Shigellosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06128  Autophagy (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
  Element
N00156  Autophagy-vesicle elongation
N00176  KSHV vFLIP to autophagy-vesicle elongation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    11337 (GABARAP)
   04068 FoxO signaling pathway
    11337 (GABARAP)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    11337 (GABARAP)
   04136 Autophagy - other
    11337 (GABARAP)
   04137 Mitophagy - animal
    11337 (GABARAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    11337 (GABARAP)
  09156 Nervous system
   04727 GABAergic synapse
    11337 (GABARAP)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    11337 (GABARAP)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    11337 (GABARAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    11337 (GABARAP)
   04121 Ubiquitin system [BR:hsa04121]
    11337 (GABARAP)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    11337 (GABARAP)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    11337 (GABARAP)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   11337 (GABARAP)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    11337 (GABARAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Atg8 APG12
Motif
Other DBs
NCBI-GeneID: 11337
NCBI-ProteinID: NP_009209
OMIM: 605125
HGNC: 4067
Ensembl: ENSG00000170296
Vega: OTTHUMG00000102156
Pharos: O95166(Tbio)
UniProt: O95166 Q6IAW1
LinkDB All DBs
Structure
PDB: 

Position
17p13.1
AA seq 117 aa AA seqDB search
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgtgtacaaagaagagcatccgttcgagaagcgccgctctgagggcgagaag
atccgaaagaaatacccggaccgggtgccggtgatagtagaaaaggctcccaaagctcgg
ataggagacctggacaaaaagaaatacctggtgccttctgatctcacagttggtcagttc
tacttcttgatccggaagcgaattcatctccgagctgaggatgccttgtttttctttgtc
aacaatgtcattccacccaccagtgccacaatgggtcagctgtaccaggaacaccatgaa
gaagacttctttctctacattgcctacagtgacgaaagtgtctacggtctgtga

DBGET integrated database retrieval system