KEGG   Homo sapiens (human): 1134
Entry
1134              CDS       T01001                                 

Gene name
CHRNA1, ACHRA, ACHRD, CHRNA, CMS1A, CMS1B, CMS2A, FCCMS, SCCMS
Definition
(RefSeq) cholinergic receptor nicotinic alpha 1 subunit
  KO
K04803  nicotinic acetylcholine receptor alpha-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00770  Congenital myasthenic syndrome
H00986  Multiple pterygium syndrome
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Cytisine: D07770
Gantacurium chloride: D04303
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Metocurine iodide: D00761
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Suxamethonium (DG00768): D00766<US> D02275<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1134 (CHRNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1134 (CHRNA1)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1134 (CHRNA1)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Other DBs
NCBI-GeneID: 1134
NCBI-ProteinID: NP_001034612
OMIM: 100690
HGNC: 1955
Ensembl: ENSG00000138435
Vega: OTTHUMG00000132357
Pharos: P02708(Tclin)
UniProt: P02708 Q53SH4
LinkDB
Structure
PDB: 
5HBT

Position
2q31.1
AA seq 482 aa
MEPWPLLLLFSLCSAGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQL
INVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGV
KKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHF
PFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPD
TPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTV
FLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHHRSPSTHVMPNWVRKV
FIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSA
IEGIKYIAETMKSDQESNNAAAEWKYVAMVMDHILLGVFMLVCIIGTLAVFAGRLIELNQ
QG
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggagccctggcctctcctcctgctctttagcctttgctcagctggcctcgtcctgggc
tccgaacatgagacccgtctggtggcaaagctatttaaagactacagcagcgtggtgcgg
ccagtggaagaccaccgccaggtcgtggaggtcaccgtgggcctgcagctgatacagctc
atcaatgtggatgaagtaaatcagatcgtgacaaccaatgtgcgtctgaaacagggtgac
atggtagatctgccacgccccagctgcgtgactttgggagttcctttgttttctcatctg
cagaatgagcaatgggtggattacaacctaaaatggaatccagatgactatggcggtgtg
aaaaaaattcacattccttcagaaaagatctggcgcccagaccttgttctctataacaat
gcagatggtgactttgctattgtcaagttcaccaaagtgctcctgcagtacactggccac
atcacgtggacacctccagccatctttaaaagctactgtgagatcatcgtcacccacttt
ccctttgatgaacagaactgcagcatgaagctgggcacctggacctacgacggctctgtc
gtggccatcaacccggaaagcgaccagccagacctgagcaacttcatggagagcggggag
tgggtgatcaaggagtcccggggctggaagcactccgtgacctattcctgctgccccgac
accccctacctggacatcacctaccacttcgtcatgcagcgcctgcccctctacttcatc
gtcaacgtcatcatcccctgcctgctcttctccttcttaactggcctggtattctacctg
cccacagactcaggggagaagatgactctgagcatctctgtcttactgtctttgactgtg
ttccttctggtcatcgtggagctgatcccctccacgtccagtgctgtgcccttgattgga
aaatacatgctgttcaccatggtgttcgtcattgcctccatcatcatcactgtcatcgtc
atcaacacacaccaccgctcacccagcacccatgtcatgcccaactgggtgcggaaggtt
tttatcgacactatcccaaatatcatgtttttctccacaatgaaaagaccatccagagaa
aagcaagacaaaaagatttttacagaagacattgatatctctgacatttctggaaagcca
gggcctccacccatgggcttccactctcccctgatcaaacaccccgaggtgaaaagtgcc
atcgagggcatcaagtacatcgcagagaccatgaagtcagaccaggagtctaacaatgcg
gcggcagagtggaagtacgttgcaatggtgatggaccacatactcctcggagtcttcatg
cttgtttgcatcatcggaaccctagccgtgtttgcaggtcgactcattgaattaaatcag
caaggatga

KEGG   Homo sapiens (human): 1135
Entry
1135              CDS       T01001                                 

Gene name
CHRNA2
Definition
(RefSeq) cholinergic receptor nicotinic alpha 2 subunit
  KO
K04804  nicotinic acetylcholine receptor alpha-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00807  Nocturnal frontal lobe epilepsy
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisine: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Rocuronium bromide: D00765<JP/US>
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1135 (CHRNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1135 (CHRNA2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1135 (CHRNA2)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD Atrophin-1 DUF2417
Other DBs
NCBI-GeneID: 1135
NCBI-ProteinID: NP_000733
OMIM: 118502
HGNC: 1956
Ensembl: ENSG00000120903
Vega: OTTHUMG00000102083
Pharos: Q15822(Tchem)
UniProt: Q15822
LinkDB
Structure
PDB: 
5FJV

Position
8p21.2
AA seq 529 aa
MGPSCPVFLSFTKLSLWWLLLTPAGGEEAKRPPPRAPGDPLSSPSPTALPQGGSHTETED
RLFKHLFRGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKL
RWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYK
SSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQMEQTVDLKDYWESGEWAIVNATGTY
NSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLC
ISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTH
TMPHWVRGALLGCVPRWLLMNRPPPPVELCHPLRLKLSPSYHWLESNVDAEEREVVVEEE
DRWACAGHVAPSVGTLCSHGHLHSGASGPKAEALLQEGELLLSPHMQKALEGVHYIADHL
RSEDADSSVKEDWKYVAMVIDRIFLWLFIIVCFLGTIGLFLPPFLAGMI
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgggcccctcctgtcctgtgttcctgtccttcacaaagctcagcctgtggtggctcctt
ctgaccccagcaggtggagaggaagctaagcgcccacctcccagggctcctggagaccca
ctctcctctcccagtcccacggcattgccgcagggaggctcgcataccgagactgaggac
cggctcttcaaacacctcttccggggctacaaccgctgggcgcgcccggtgcccaacact
tcagacgtggtgattgtgcgctttggactgtccatcgctcagctcatcgatgtggatgag
aagaaccaaatgatgaccaccaacgtctggctaaaacaggagtggagcgactacaaactg
cgctggaaccccactgattttggcaacatcacatctctcagggtcccttctgagatgatc
tggatccccgacattgttctctacaacaatgcagatggggagtttgcagtgacccacatg
accaaggcccacctcttctccacgggcactgtgcactgggtgcccccggccatctacaag
agctcctgcagcatcgacgtcaccttcttccccttcgaccagcagaactgcaagatgaag
tttggctcctggacttatgacaaggccaagatcgacctggagcagatggagcagactgtg
gacctgaaggactactgggagagcggcgagtgggccatcgtcaatgccacgggcacctac
aacagcaagaagtacgactgctgcgccgagatctaccccgacgtcacctacgccttcgtc
atccggcggctgccgctcttctacaccatcaacctcatcatcccctgcctgctcatctcc
tgcctcactgtgctggtcttctacctgccctccgactgcggcgagaagatcacgctgtgc
atttcggtgctgctgtcactcaccgtcttcctgctgctcatcactgagatcatcccgtcc
acctcgctggtcatcccgctcatcggcgagtacctgctgttcaccatgatcttcgtcacc
ctgtccatcgtcatcaccgtcttcgtgctcaatgtgcaccaccgctcccccagcacccac
accatgccccactgggtgcggggggcccttctgggctgtgtgccccggtggcttctgatg
aaccggcccccaccacccgtggagctctgccaccccctacgcctgaagctcagcccctct
tatcactggctggagagcaacgtggatgccgaggagagggaggtggtggtggaggaggag
gacagatgggcatgtgcaggtcatgtggccccctctgtgggcaccctctgcagccacggc
cacctgcactctggggcctcaggtcccaaggctgaggctctgctgcaggagggtgagctg
ctgctatcaccccacatgcagaaggcactggaaggtgtgcactacattgccgaccacctg
cggtctgaggatgctgactcttcggtgaaggaggactggaagtatgttgccatggtcatc
gacaggatcttcctctggctgtttatcatcgtctgcttcctggggaccatcggcctcttt
ctgcctccgttcctagctggaatgatctga

KEGG   Homo sapiens (human): 1136
Entry
1136              CDS       T01001                                 

Gene name
CHRNA3, BAIPRCK, LNCR2, NACHRA3, PAOD2
Definition
(RefSeq) cholinergic receptor nicotinic alpha 3 subunit
  KO
K04805  nicotinic acetylcholine receptor alpha-3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisine: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Rocuronium bromide: D00765<JP/US>
Tebanicline tosylate: D06016
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1136 (CHRNA3)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1136 (CHRNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1136 (CHRNA3)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1136 (CHRNA3)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD FtsK_alpha
Other DBs
NCBI-GeneID: 1136
NCBI-ProteinID: NP_000734
OMIM: 118503
HGNC: 1957
Ensembl: ENSG00000080644
Vega: OTTHUMG00000143863
Pharos: P32297(Tclin)
UniProt: P32297
LinkDB
Position
15q25.1
AA seq 505 aa
MGSGPLSLPLALSPPRLLLLLLLSLLPVARASEAEHRLFERLFEDYNEIIRPVANVSDPV
IIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPD
IVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSW
SYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
PLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLV
IPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPT
SNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLT
RSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFL
WVFTLVCILGTAGLFLQPLMAREDA
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgggctctggcccgctctcgctgcccctggcgctgtcgccgccgcggctgctgctgctg
ctgctgctgtctctgctgccagtggccagggcctcagaggctgagcaccgtctatttgag
cggctgtttgaagattacaatgagatcatccggcctgtagccaacgtgtctgacccagtc
atcatccatttcgaggtgtccatgtctcagctggtgaaggtggatgaagtaaaccagatc
atggagaccaacctgtggctcaagcaaatctggaatgactacaagctgaaatggaacccc
tctgactatggtggggcagagttcatgcgtgtccctgcacagaagatctggaagccagac
attgtgctgtataacaatgctgttggggatttccaggtggacgacaagaccaaagcctta
ctcaagtacactggggaggtgacttggatacctccggccatctttaagagctcctgtaaa
atcgacgtgacctacttcccgtttgattaccaaaactgtaccatgaagttcggttcctgg
tcctacgataaggcgaaaatcgatctggtcctgatcggctcttccatgaacctcaaggac
tattgggagagcggcgagtgggccatcatcaaagccccaggctacaaacacgacatcaag
tacaactgctgcgaggagatctaccccgacatcacatactcgctgtacatccggcgcctg
cccttgttctacaccatcaacctcatcatcccctgcctgctcatctccttcctcactgtg
ctcgtcttctacctgccctccgactgcggtgagaaggtgaccctgtgcatttctgtcctc
ctctccctgacggtgtttctcctggtgatcactgagaccatcccttccacctcgctggtc
atccccctgattggagagtacctcctgttcaccatgatttttgtaaccttgtccatcgtc
atcaccgtcttcgtgctcaacgtgcactacagaaccccgacgacacacacaatgccctca
tgggtgaagactgtattcttgaacctgctccccagggtcatgttcatgaccaggccaaca
agcaacgagggcaacgctcagaagccgaggcccctctacggtgccgagctctcaaatctg
aattgcttcagccgcgcagagtccaaaggctgcaaggagggctacccctgccaggacggg
atgtgtggttactgccaccaccgcaggataaaaatctccaatttcagtgctaacctcacg
agaagctctagttctgaatctgttgatgctgtgctgtccctctctgctttgtcaccagaa
atcaaagaagccatccaaagtgtcaagtatattgctgaaaatatgaaagcacaaaatgaa
gccaaagagattcaagatgattggaagtatgttgccatggtgattgatcgtatttttctg
tgggttttcaccctggtgtgcattctagggacagcaggattgtttctgcaacccctgatg
gccagggaagatgcataa

KEGG   Homo sapiens (human): 1137
Entry
1137              CDS       T01001                                 

Gene name
CHRNA4, BFNC, EBN, EBN1, NACHR, NACHRA4, NACRA4
Definition
(RefSeq) cholinergic receptor nicotinic alpha 4 subunit
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa05033  Nicotine addiction
Disease
H00807  Nocturnal frontal lobe epilepsy
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Altinicline maleate: D02839
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisine: D07770
Dexmecamylamine (DG01378): D10111 D10112
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Ispronicline: D08935
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Pozanicline (DG01288): D09367 D09368
Rivanicline galactarate: D08987
Rocuronium bromide: D00765<JP/US>
Sofinicline (DG01286): D09382 D09383
Tebanicline tosylate: D06016
Tubocurarine (DG00767): D02207 D08655
Varenicline (DG00995): D06282<JP/US> D08669
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1137 (CHRNA4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1137 (CHRNA4)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    1137 (CHRNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1137 (CHRNA4)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1137 (CHRNA4)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD Blt1
Other DBs
NCBI-GeneID: 1137
NCBI-ProteinID: NP_000735
OMIM: 118504
HGNC: 1958
Ensembl: ENSG00000101204
Vega: OTTHUMG00000033080
Pharos: P43681(Tclin)
UniProt: P43681 Q59FV0 B4DK78
LinkDB
Structure
PDB: 
6CNJ 6CNK 5KXI 2LLY

Position
20q13.33
AA seq 627 aa
MELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKWSRPVANISD
VVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWR
PDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFG
SWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIR
RLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTS
LVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLMKR
PSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGP
SCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEG
GVRCRSRSIQYCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSV
SPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDR
IFLWMFIIVCLLGTVGLFLPPWLAGMI
NT seq 1884 nt   +upstreamnt  +downstreamnt
atggagctagggggccccggagcgccgcggctgctgccgccgctgctgctgcttctgggg
accggcctcctgcgcgccagcagccatgtggagacccgggcccacgccgaggagcggctc
ctgaagaaactcttctccggttacaacaagtggtcccgacccgtggccaacatctcggac
gtggtcctcgtccgcttcggcctgtccatcgctcagctcattgacgtggatgagaagaac
cagatgatgaccacgaacgtatgggtgaagcaggagtggcacgactacaagctgcgctgg
gacccagctgactatgagaatgtcacctccatccgcatcccctccgagctcatctggcgg
ccggacatcgtcctctacaacaatgctgacggggacttcgcggtcacccacctgaccaag
gcccacctgttccatgacgggcgggtgcagtggactcccccggccatttacaagagctcc
tgcagcatcgacgtcaccttcttccccttcgaccagcagaactgcaccatgaaattcggc
tcctggacctacgacaaggccaagatcgacctggtgaacatgcacagccgcgtggaccag
ctggacttctgggagagtggcgagtgggtcatcgtggatgccgtgggcacctacaacacc
aggaagtacgagtgctgtgccgagatctacccggacatcacctatgccttcgtcatccgg
cggctgccgctcttctacaccatcaacctcatcatcccctgcctgctcatctcctgcctc
accgtgctggtcttctacctgccctccgagtgtggcgagaagatcacgctgtgcatctcc
gtgctgctgtcgctcaccgtcttcctgctgctcatcaccgagatcatcccgtccacctca
ctggtcatcccactcatcggcgagtacctgctgttcaccatgatcttcgtcaccctgtcc
atcgtcatcacggtcttcgtgctcaacgtgcaccaccgctcgccacgcacgcacaccatg
cccacctgggtacgcagggtcttcctggacatcgtgccacgcctgctcctcatgaagcgg
ccgtccgtggtcaaggacaattgccggcggctcatcgagtccatgcataagatggccagt
gccccgcgcttctggcccgagccagaaggggagccccctgccacgagcggcacccagagc
ctgcacccgccctcaccgtccttctgtgtccccctggatgtgccggctgagcctgggcct
tcctgcaagtcaccctccgaccagctccctcctcagcagcccctggaagctgagaaagcc
agcccccacccctcgcctggaccctgccgcccgccccacggcacccaggcaccagggctg
gccaaagccaggtccctcagcgtccagcacatgtccagccctggcgaagcggtggaaggc
ggcgtccggtgccggtctcggagcatccagtactgtgttccccgagacgatgccgccccc
gaggcagatggccaggctgccggcgccctggcctctcgcaacacccactcggctgagctc
ccacccccagaccagccctctccgtgcaaatgcacatgcaagaaggagccctcttcggtg
tccccgagcgccacggtcaagacccgcagcaccaaagcgccgcccccgcacctgcccctg
tcgccggccctgacccgggcggtggagggcgtccagtacattgcagaccacctgaaggcc
gaagacacagacttctcggtgaaggaggactggaagtacgtggccatggtcatcgaccgc
atcttcctctggatgttcatcatcgtctgcctgctggggacggtgggcctcttcctgccg
ccctggctggctggcatgatctag

KEGG   Homo sapiens (human): 1138
Entry
1138              CDS       T01001                                 

Gene name
CHRNA5, LNCR2
Definition
(RefSeq) cholinergic receptor nicotinic alpha 5 subunit
  KO
K04807  nicotinic acetylcholine receptor alpha-5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisine: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Rocuronium bromide: D00765<JP/US>
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1138 (CHRNA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1138 (CHRNA5)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1138 (CHRNA5)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 1138
NCBI-ProteinID: NP_000736
OMIM: 118505
HGNC: 1959
Ensembl: ENSG00000169684
Vega: OTTHUMG00000143858
Pharos: P30532(Tbio)
UniProt: P30532 Q6EWN4
LinkDB
Position
15q25.1
AA seq 468 aa
MAARGSGPRALRLLLLVQLVAGRCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYER
WVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKV
IRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD
LQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYV
TYSFVIKRLPLFYTLFLIIPCIGLSFLTVLVFYLPSNEGEKICLCTSVLVSLTVFLLVIE
EIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPLVRKIFLHTL
PKLLCMRSHVDRYFTQKEETESGSGPKSSRNTLEAALDSIRYITRHIMKENDVREVVEDW
KFIAQVLDRMFLWTFLFVSIVGSLGLFVPVIYKWANILIPVHIGNANK
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggcggcgcgggggtcagggccccgcgcgctccgcctgctgctcttggtccagctggtc
gcggggcgctgcggtctagcgggcgcggcgggcggcgcgcagagaggattatctgaacct
tcttctattgcaaaacatgaagatagtttgcttaaggatttatttcaagactacgaaaga
tgggttcgtcctgtggaacacctgaatgacaaaataaaaataaaatttggacttgcaata
tctcaattggtggatgtggatgagaaaaatcagttaatgacaacaaacgtctggttgaaa
caggaatggatagatgtaaaattaagatggaaccctgatgactatggtggaataaaagtt
atacgtgttccttcagactctgtctggacaccagacatcgttttgtttgataatgcagat
ggacgttttgaagggaccagtacgaaaacagtcatcaggtacaatggcactgtcacctgg
actccaccggcaaactacaaaagttcctgtaccatagatgtcacgtttttcccatttgac
cttcagaactgttccatgaaatttggttcttggacttatgatggatcacaggttgatata
attctagaggaccaagatgtagacaagagagatttttttgataatggagaatgggagatt
gtgagtgcaacagggagcaaaggaaacagaaccgacagctgttgctggtatccgtatgtc
acttactcatttgtaatcaagcgcctgcctctcttttataccttgttccttataataccc
tgtattgggctctcatttttaactgtacttgtcttctatcttccttcaaatgaaggtgaa
aagatttgtctctgcacttcagtacttgtgtctttgactgtcttccttctggttattgaa
gagatcataccatcatcttcaaaagtcatacctctaattggagagtatctggtatttacc
atgatttttgtgacactgtcaattatggtaaccgtcttcgctatcaacattcatcatcgt
tcttcctcaacacataatgccatggcgcctttggtccgcaagatatttcttcacacgctt
cccaaactgctttgcatgagaagtcatgtagacaggtacttcactcagaaagaggaaact
gagagtggtagtggaccaaaatcttctagaaacacattggaagctgcgctcgattctatt
cgctacattacaagacacatcatgaaggaaaatgatgtccgtgaggttgttgaagattgg
aaattcatagcccaggttcttgatcggatgtttctgtggacttttcttttcgtttcaatt
gttggatctcttgggctttttgttcctgttatttataaatgggcaaatatattaatacca
gttcatattggaaatgcaaataagtga

KEGG   Homo sapiens (human): 1139
Entry
1139              CDS       T01001                                 

Gene name
CHRNA7, CHRNA7-2, NACHRA7
Definition
(RefSeq) cholinergic receptor nicotinic alpha 7 subunit
  KO
K04809  nicotinic acetylcholine receptor alpha-7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05033  Nicotine addiction
hsa05204  Chemical carcinogenesis
Network
nt06418  Oxidative phosphorylation
nt06419  Microtubule-based transport
nt06460  Alzheimer disease
  Element
N00997  Mutation-caused aberrant Abeta to electron transfer in Complex I
N01018  Mutation-caused aberrant Abeta to anterograde axonal transport
Disease
H01877  Chromosome 15q13.3 microdeletion syndrome
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Atracurium (DG00771): D00758<US>
Bradanicline (DG01849): D10613 D10693
Cisatracurium: D00759<US>
Cytisine: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Encenicline (DG01852): D10626 D10702 D10789
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Rocuronium bromide: D00765<JP/US>
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    1139 (CHRNA7)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1139 (CHRNA7)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1139 (CHRNA7)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    1139 (CHRNA7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1139 (CHRNA7)
   05022 Pathways of neurodegeneration - multiple diseases
    1139 (CHRNA7)
  09165 Substance dependence
   05033 Nicotine addiction
    1139 (CHRNA7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1139 (CHRNA7)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1139 (CHRNA7)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb SUR7
Other DBs
NCBI-GeneID: 1139
NCBI-ProteinID: NP_000737
OMIM: 118511
HGNC: 1960
Ensembl: ENSG00000175344
Vega: OTTHUMG00000129285
UniProt: P36544
LinkDB
Structure
PDB: 
2MAW

Position
15q13.3
AA seq 502 aa
MRCSPGGVWLALAASLLHVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLL
QIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADE
RFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDL
QMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIP
CVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST
MIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK
QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHL
LHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTI
ICTIGILMSAPNFVEAVSKDFA
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgcgctgctcgccgggaggcgtctggctggcgctggccgcgtcgctcctgcacgtgtcc
ctgcaaggcgagttccagaggaagctttacaaggagctggtcaagaactacaatcccttg
gagaggcccgtggccaatgactcgcaaccactcaccgtctacttctccctgagcctcctg
cagatcatggacgtggatgagaagaaccaagttttaaccaccaacatttggctgcaaatg
tcttggacagatcactatttacagtggaatgtgtcagaatatccaggggtgaagactgtt
cgtttcccagatggccagatttggaaaccagacattcttctctataacagtgctgatgag
cgctttgacgccacattccacactaacgtgttggtgaattcttctgggcattgccagtac
ctgcctccaggcatattcaagagttcctgctacatcgatgtacgctggtttccctttgat
gtgcagcactgcaaactgaagtttgggtcctggtcttacggaggctggtccttggatctg
cagatgcaggaggcagatatcagtggctatatccccaatggagaatgggacctagtggga
atccccggcaagaggagtgaaaggttctatgagtgctgcaaagagccctaccccgatgtc
accttcacagtgaccatgcgccgcaggacgctctactatggcctcaacctgctgatcccc
tgtgtgctcatctccgccctcgccctgctggtgttcctgcttcctgcagattccggggag
aagatttccctggggataacagtcttactctctcttaccgtcttcatgctgctcgtggct
gagatcatgcccgcaacatccgattcggtaccattgatagcccagtacttcgccagcacc
atgatcatcgtgggcctctcggtggtggtgacagtgatcgtgctgcagtaccaccaccac
gaccccgacgggggcaagatgcccaagtggaccagagtcatccttctgaactggtgcgcg
tggttcctgcgaatgaagaggcccggggaggacaaggtgcgcccggcctgccagcacaag
cagcggcgctgcagcctggccagtgtggagatgagcgccgtggcgccgccgcccgccagc
aacgggaacctgctgtacatcggcttccgcggcctggacggcgtgcactgtgtcccgacc
cccgactctggggtagtgtgtggccgcatggcctgctcccccacgcacgatgagcacctc
ctgcacggcgggcaaccccccgagggggacccggacttggccaagatcctggaggaggtc
cgctacattgccaaccgcttccgctgccaggacgaaagcgaggcggtctgcagcgagtgg
aagttcgccgcctgtgtggtggaccgcctgtgcctcatggccttctcggtcttcaccatc
atctgcaccatcggcatcctgatgtcggctcccaacttcgtggaggccgtgtccaaagac
tttgcgtaa

KEGG   Homo sapiens (human): 1140
Entry
1140              CDS       T01001                                 

Gene name
CHRNB1, ACHRB, CHRNB, CMS1D, CMS2A, CMS2C, SCCMS
Definition
(RefSeq) cholinergic receptor nicotinic beta 1 subunit
  KO
K04812  nicotinic acetylcholine receptor beta-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00770  Congenital myasthenic syndrome
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Cytisine: D07770
Gantacurium chloride: D04303
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Metocurine iodide: D00761
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Suxamethonium (DG00768): D00766<US> D02275<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1140 (CHRNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1140 (CHRNB1)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1140 (CHRNB1)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Other DBs
NCBI-GeneID: 1140
NCBI-ProteinID: NP_000738
OMIM: 100710
HGNC: 1961
Ensembl: ENSG00000170175
Vega: OTTHUMG00000108139
Pharos: P11230(Tclin)
UniProt: P11230
LinkDB
Position
17p13.1
AA seq 501 aa
MTPGALLMLLGALGAPLAPGVRGSEAEGRLREKLFSGYDSSVRPAREVGDRVRVSVGLIL
AQLISLNEKDEEMSTKVYLDLEWTDYRLSWDPAEHDGIDSLRITAESVWLPDVVLLNNND
GNFDVALDISVVVSSDGSVRWQPPGIYRSSCSIQVTYFPFDWQNCTMVFSSYSYDSSEVS
LQTGLGPDGQGHQEIHIHEGTFIENGQWEIIHKPSRLIQPPGDPRGGREGQRQEVIFYLI
IRRKPLFYLVNVIAPCILITLLAIFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPE
TSLSVPIIIKYLMFTMVLVTFSVILSVVVLNLHHRSPHTHQMPLWVRQIFIHKLPLYLRL
KRPKPERDLMPEPPHCSSPGSGWGRGTDEYFIRKPPSDFLFPKPNRFQPELSAPDLRRFI
DGPNRAVALLPELREVVSSISYIARQLQEQEDHDALKEDWQFVAMVVDRLFLWTFIIFTS
VGTLVIFLDATYHLPPPDPFP
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgaccccaggggctctgctgatgctgctgggggcgctgggggcgccgctcgccccaggc
gtccgcggctcggaggcggagggtcgactccgggagaaacttttctctggctatgatagc
tccgtgcggccagcgcgggaggtgggagaccgtgtcagggtcagcgttggtctcatcctg
gcgcaactcatcagcctgaacgagaaggatgaagagatgagcacaaaggtgtacttagac
ctggagtggactgactacaggctgagctgggaccctgcggagcacgacggcatcgattcg
ctccgcatcacggcggaatccgtgtggctccctgacgtggtgctactgaacaacaatgat
gggaattttgacgtggctctggacattagcgtcgtggtgtcctccgacggctccgtgcgt
tggcaacccccgggcatctatcgcagcagctgcagcatccaggtcacctacttccccttc
gactggcagaattgcactatggtgttcagctcctacagctacgacagctcggaggtcagc
ctgcagacaggcctgggtcctgacgggcaagggcatcaggaaatccacattcatgaaggg
actttcattgagaatggccagtgggagattatccacaagccctctcggctaatccagcct
ccaggcgatcctaggggagggagggaaggacagcgccaggaagtcatcttctacctcatc
atccgccgcaagcctctcttctacctggtcaacgtcattgccccatgcatcctcatcact
cttctggccatcttcgtcttctacctgccaccagatgcaggagagaagatggggctctca
atctttgccctgctgacccttactgtgttcctgctgctgctggctgacaaagtacctgag
acctcactatcagtacccattattatcaagtacctcatgtttaccatggtcctcgtcacc
ttctcagtcatccttagtgtcgtggttctcaacctgcaccaccgctcaccccacacccac
caaatgcccctttgggtccgtcagatcttcattcacaaacttccgctgtacctgcgtcta
aaaaggcccaaacccgagagagacctgatgccggagccccctcactgttcttctccagga
agtggctggggtcggggaacagatgaatatttcatccggaagccgccaagtgattttctc
ttccccaaacccaataggttccagcctgaactgtctgcccctgatctgcggcgatttatc
gatggtccaaaccgggctgtggccctgcttccggagctacgggaggtcgtctcctctatc
agctacatcgctcgacagctgcaggaacaggaggaccacgatgcgctgaaggaggactgg
cagtttgtggccatggtagtggaccgcctcttcctgtggactttcatcatcttcaccagc
gttgggaccctagtcatcttcctggacgccacgtaccacttgccccctccagaccccttt
ccttga

KEGG   Homo sapiens (human): 1141
Entry
1141              CDS       T01001                                 

Gene name
CHRNB2, EFNL3, nAChRB2
Definition
(RefSeq) cholinergic receptor nicotinic beta 2 subunit
  KO
K04813  nicotinic acetylcholine receptor beta-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa05033  Nicotine addiction
Disease
H00807  Nocturnal frontal lobe epilepsy
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Altinicline maleate: D02839
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisine: D07770
Dexmecamylamine (DG01378): D10111 D10112
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Ispronicline: D08935
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Pozanicline (DG01288): D09367 D09368
Rivanicline galactarate: D08987
Rocuronium bromide: D00765<JP/US>
Sofinicline (DG01286): D09382 D09383
Tebanicline tosylate: D06016
Tubocurarine (DG00767): D02207 D08655
Varenicline (DG00995): D06282<JP/US> D08669
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1141 (CHRNB2)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1141 (CHRNB2)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    1141 (CHRNB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1141 (CHRNB2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1141 (CHRNB2)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Other DBs
NCBI-GeneID: 1141
NCBI-ProteinID: NP_000739
OMIM: 118507
HGNC: 1962
Ensembl: ENSG00000160716
Vega: OTTHUMG00000037262
Pharos: P17787(Tclin)
UniProt: P17787 Q5SXY3
LinkDB
Structure
PDB: 
6CNJ 6CNK 5KXI 2LM2 2KSR

Position
1q21.3
AA seq 502 aa
MARRCGPVALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQL
MVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLY
NNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDR
TEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRKPLFYTIN
LIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKY
LMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPRHHCARQR
LRLRRRQREREGAGALFFREAPGADSCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPC
GCGLREAVDGVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQ
PLFQNYTTTTFLHSDHSAPSSK
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggcccggcgctgcggccccgtggcgctgctccttggcttcggcctcctccggctgtgc
tcaggggtgtggggtacggatacagaggagcggctggtggagcatctcctggatccttcc
cgctacaacaagcttatccgcccagccaccaatggctctgagctggtgacagtacagctt
atggtgtcactggcccagctcatcagtgtgcatgagcgggagcagatcatgaccaccaat
gtctggctgacccaggagtgggaagattatcgcctcacctggaagcctgaagagtttgac
aacatgaagaaagttcggctcccttccaaacacatctggctcccagatgtggtcctgtac
aacaatgctgacggcatgtacgaggtgtccttctattccaatgccgtggtctcctatgat
ggcagcatcttctggctgccgcctgccatctacaagagcgcatgcaagattgaagtaaag
cacttcccatttgaccagcagaactgcaccatgaagttccgttcgtggacctacgaccgc
acagagatcgacttggtgctgaagagtgaggtggccagcctggacgacttcacacctagt
ggtgagtgggacatcgtggcgctgccgggccggcgcaacgagaaccccgacgactctacg
tacgtggacatcacgtatgacttcatcattcgccgcaagccgctcttctacaccatcaac
ctcatcatcccctgtgtgctcatcacctcgctagccatccttgtcttctacctgccatcc
gactgtggcgagaagatgacgttgtgcatctcagtgctgctggcgctcacggtcttcctg
ctgctcatctccaagatcgtgcctcccacctccctcgacgtgccgctcgtcggcaagtac
ctcatgttcaccatggtgcttgtcaccttctccatcgtcaccagcgtgtgcgtgctcaac
gtgcaccaccgctcgcccaccacgcacaccatggcgccctgggtgaaggtcgtcttcctg
gagaagctgcccgcgctgctcttcatgcagcagccacgccatcattgcgcccgtcagcgc
ctgcgcctgcggcgacgccagcgtgagcgcgagggcgctggagccctcttcttccgcgaa
gccccaggggccgactcctgcacgtgcttcgtcaaccgcgcgtcggtgcaggggttggcc
ggggccttcggggctgagcctgcaccagtggcgggccccgggcgctcaggggagccgtgt
ggctgtggcctccgggaggcggtggacggcgtgcgcttcatcgcagaccacatgcggagc
gaggacgatgaccagagcgtgagtgaggactggaagtacgtcgccatggtgatcgaccgc
ctcttcctctggatctttgtctttgtctgtgtctttggcaccatcggcatgttcctgcag
cctctcttccagaactacaccaccaccaccttcctccactcagaccactcagcccccagc
tccaagtga

KEGG   Homo sapiens (human): 1142
Entry
1142              CDS       T01001                                 

Gene name
CHRNB3
Definition
(RefSeq) cholinergic receptor nicotinic beta 3 subunit
  KO
K04814  nicotinic acetylcholine receptor beta-3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisine: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Rocuronium bromide: D00765<JP/US>
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1142 (CHRNB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1142 (CHRNB3)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1142 (CHRNB3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb PepSY_TM
Other DBs
NCBI-GeneID: 1142
NCBI-ProteinID: NP_000740
OMIM: 118508
HGNC: 1963
Ensembl: ENSG00000147432
Vega: OTTHUMG00000165262
Pharos: Q05901(Tchem)
UniProt: Q05901
LinkDB
Position
8p11.21
AA seq 458 aa
MLPDFMLVLIVLGIPSSATTGFNSIAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGL
KISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFEN
ADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTM
VDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITYSFVLRRLPLFYTLFL
IIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYL
LFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQKLPKLLCMKDHVDRYSSPE
KEESQPVVKGKVLEKKKQKQLSDGEKVLVAFLEKAADSIRYISRHVKKEHFISQVVQDWK
FVAQVLDRIFLWLFLIVSVTGSVLIFTPALKMWLHSYH
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgctcccagattttatgctggttctcatcgtccttggcatcccttcctcagccaccaca
ggtttcaactcaatcgccgaaaatgaagatgccctcctcagacatttgttccaaggttat
cagaaatgggtccgccctgtattacattctaatgacaccataaaagtatattttggattg
aaaatatcccagcttgtagatgtggatgaaaagaatcagctgatgacaaccaatgtgtgg
ctcaaacaggaatggacagaccacaagttacgctggaatcctgatgattatggtgggatc
cattccattaaagttccatcagaatctctgtggcttcctgacatagttctctttgaaaat
gctgacggccgcttcgaaggctccctgatgaccaaggtcatcgtgaaatcaaacggaact
gttgtctggacccctcccgccagctacaaaagctcctgcaccatggacgtcacgtttttc
ccgttcgaccgacagaactgctccatgaagtttggatcctggacttatgatggcaccatg
gttgacctcattttgatcaatgaaaatgtcgacagaaaagacttcttcgataacggagaa
tgggaaatactgaacgcaaaggggatgaaggggaacagaagggacggcgtgtactcctat
ccctttatcacgtattccttcgtcctgagacgcctgcctttattctataccctctttctc
atcatcccctgcctggggctgtctttcctaacagttcttgtgttctatttaccttcggat
gaaggagaaaaactttcattatccacatcggtcttggtttctctgacagttttcctttta
gtgattgaagaaatcatcccatcgtcttccaaagtcattcctctcattggagagtacctg
ctgttcatcatgatttttgtgaccctgtccatcattgttaccgtgtttgtcattaacgtt
caccacagatcttcttccacgtaccaccccatggccccctgggttaagaggctctttctg
cagaaacttccaaaattactttgcatgaaagatcatgtggatcgctactcatccccagag
aaagaggagagtcaaccagtagtgaaaggcaaagtcctcgaaaaaaagaaacagaaacag
cttagtgatggagaaaaagttctagttgcttttttggaaaaagctgctgattccattaga
tacatttcgagacatgtgaagaaagaacattttatcagccaggtagtacaagactggaaa
tttgtagctcaagttcttgaccgaatcttcctgtggctctttctgatagtgtcagtaaca
ggctcggttctgatttttacccctgctttgaagatgtggctacatagttaccattag

KEGG   Homo sapiens (human): 1143
Entry
1143              CDS       T01001                                 

Gene name
CHRNB4
Definition
(RefSeq) cholinergic receptor nicotinic beta 4 subunit
  KO
K04815  nicotinic acetylcholine receptor beta-4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisine: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Rocuronium bromide: D00765<JP/US>
Tebanicline tosylate: D06016
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1143 (CHRNB4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1143 (CHRNB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1143 (CHRNB4)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1143 (CHRNB4)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Other DBs
NCBI-GeneID: 1143
NCBI-ProteinID: NP_000741
OMIM: 118509
HGNC: 1964
Ensembl: ENSG00000117971
Vega: OTTHUMG00000143860
Pharos: P30926(Tclin)
UniProt: P30926
LinkDB
Position
15q25.1
AA seq 498 aa
MRRAPSLVLFFLVALCGRGNCRVANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIKLQL
SLAQLISVNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNN
ADGTYEVSVYTNLIVRSNGSVLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYDHTE
IDMVLMTPTASMDDFTPSGEWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLI
IPCVLTTLLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDVPLIGKYLM
FTMVLVTFSIVTSVCVLNVHHRSPSTHTMAPWVKRCFLHKLPTFLFMKRPGPDSSPARAF
PPSKSCVTKPEATATSTSPSNFYGNSMYFVNPASAASKSPAGSTPVAIPRDFWLRSSGRF
RQDVQEALEGVSFIAQHMKNDDEDQSVVEDWKYVAMVVDRLFLWVFMFVCVLGTVGLFLP
PLFQTHAASEGPYAAQRD
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgaggcgcgcgccttccctggtccttttcttcctggtcgccctttgcgggcgcgggaac
tgccgcgtggccaatgcggaggaaaagctgatggacgaccttctgaacaaaacccgttac
aataacctgatccgcccagccaccagctcctcacagctcatctccatcaagctgcagctc
tccctggcccagcttatcagcgtgaatgagcgagagcagatcatgaccaccaatgtctgg
ctgaaacaggaatggactgattaccgcctgacctggaacagctcccgctacgagggtgtg
aacatcctgaggatccctgcaaagcgcatctggttgcctgacatcgtgctttacaacaac
gccgacgggacctatgaggtgtctgtctacaccaacttgatagtccggtccaacggcagc
gtcctgtggctgccccctgccatctacaagagcgcctgcaagattgaggtgaagtacttt
cccttcgaccagcagaactgcaccctcaagttccgctcctggacctatgaccacacggag
atagacatggtcctcatgacgcccacagccagcatggatgactttactcccagtggtgag
tgggacatagtggccctcccagggagaaggacagtgaacccacaagaccccagctacgtg
gacgtgacttacgacttcatcatcaagcgcaagcctctgttctacaccatcaacctcatc
atcccctgcgtgctcaccaccttgctggccatcctcgtcttctacctgccatccgactgc
ggcgagaagatgacactgtgcatctcagtgctgctggcactgacattcttcctgctgctc
atctccaagatcgtgccacccacctccctcgatgtgcctctcatcggcaagtacctcatg
ttcaccatggtgctggtcaccttctccatcgtcaccagcgtctgtgtgctcaatgtgcac
caccgctcgcccagcacccacaccatggcaccctgggtcaagcgctgcttcctgcacaag
ctgcctaccttcctcttcatgaagcgccctggccccgacagcagcccggccagagccttc
ccgcccagcaagtcatgcgtgaccaagcccgaggccaccgccacctccaccagcccctcc
aacttctatgggaactccatgtactttgtgaaccccgcctctgcagcttccaagtctcca
gccggctctaccccggtggctatccccagggatttctggctgcggtcctctgggaggttc
cgacaggatgtgcaggaggcattagaaggtgtcagcttcatcgcccagcacatgaagaat
gacgatgaagaccagagtgtcgttgaggactggaagtacgtggctatggtggtggaccgg
ctgttcctgtgggtgttcatgtttgtgtgcgtcctgggcactgtggggctcttcctaccg
cccctcttccagacccatgcagcttctgaggggccctacgctgcccagcgtgactga

KEGG   Homo sapiens (human): 1144
Entry
1144              CDS       T01001                                 

Gene name
CHRND, ACHRD, CMS2A, CMS3A, CMS3B, CMS3C, FCCMS, SCCMS
Definition
(RefSeq) cholinergic receptor nicotinic delta subunit
  KO
K04816  nicotinic acetylcholine receptor delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00770  Congenital myasthenic syndrome
H00986  Multiple pterygium syndrome
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Cytisine: D07770
Gantacurium chloride: D04303
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Metocurine iodide: D00761
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Suxamethonium (DG00768): D00766<US> D02275<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1144 (CHRND)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1144 (CHRND)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1144 (CHRND)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Other DBs
NCBI-GeneID: 1144
NCBI-ProteinID: NP_000742
OMIM: 100720
HGNC: 1965
Ensembl: ENSG00000135902
Vega: OTTHUMG00000133261
Pharos: Q07001(Tclin)
UniProt: Q07001
LinkDB
Position
2q37.1
AA seq 517 aa
MEGPVLTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTL
SNLISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNND
GSFQISYSCNVLVYHYGFVYWLPPAIFRSSCPISVTYFPFDWQNCSLKFSSLKYTAKEIT
LSLKQDAKENRTYPVEWIIIDPEGFTENGEWEIVHRPARVNVDPRAPLDSPSRQDITFYL
IIRRKPLFYIINILVPCVLISFMVNLVFYLPADSGEKTSVAISVLLAQSVFLLLISKRLP
ATSMAIPLIGKFLLFGMVLVTMVVVICVIVLNIHFRTPSTHVLSEGVKKLFLETLPELLH
MSRPAEDGPSPGALVRRSSSLGYISKAEEYFLLKSRSDLMFEKQSERHGLARRLTTARRP
PASSEQAQQELFNELKPAVDGANFIVNHMRDQNNYNEEKDSWNRVARTVDRLCLFVVTPV
MVVGTAWIFLQGVYNQPPPQPFPGDPYSYNVQDKRFI
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggaggggccagtgctgacactggggctgctggctgccctggcggtgtgtggcagctgg
gggctgaacgaggaggagcggctgatccggcacctgtttcaagagaagggctacaacaag
gagctccggcccgtggcacacaaagaggagagtgtggacgttgccctggccctcacactc
tccaacctcatctccctgaaagaagttgaggagaccctcactaccaatgtgtggatagag
cacggctggacagacaaccggctgaagtggaatgctgaagaatttggaaacatcagtgtc
ctgcgcctccccccggacatggtgtggctcccagagattgtgctggagaacaacaatgac
ggctccttccagatctcctactcctgcaacgtgcttgtctaccactacggcttcgtgtac
tggctgccacctgccatcttccgctcctcctgccccatctctgtcacctatttccccttc
gactggcagaactgctccctcaagttcagttccctcaagtatacggccaaagagatcacc
ctgagcctgaaacaggatgccaaggagaaccgcacctaccccgtggagtggatcatcatt
gatcctgaaggcttcacagagaacggggagtgggagatagtccaccggccggccagggtc
aacgtggaccccagagcccctctggacagccccagccgccaggacatcaccttctacctc
atcatccgccgcaagcccctcttctacatcatcaacatcctggtgccctgcgtgctcatc
tccttcatggtcaacctggtcttctacctaccggctgacagtggtgagaagacatcagtg
gccatctcggtgctcctggctcagtctgtcttcctgctgctcatctccaagcgtctgcct
gccacatccatggccatcccccttatcggcaagttcctgctcttcggcatggtgctggtc
accatggttgtggtgatctgtgtcatcgtgctcaacatccacttccgaacacccagcacc
catgtgctgtctgagggggtcaagaagctcttcctggagaccctgccggagctcctgcac
atgtcccgcccagcagaggatggacccagccctggggccctggtgcggaggagcagctcc
ctgggatacatctccaaggccgaggagtacttcctgctcaagtcccgcagtgacctcatg
ttcgagaagcagtcagagcggcatgggctggccaggcgcctcaccactgcacgccggccc
ccagcaagctctgagcaggcccagcaggaactcttcaatgagctgaagccagctgtggat
ggggcaaacttcattgttaaccacatgagggaccagaacaattacaatgaggagaaagac
agctggaaccgagtggcccgcacagtggaccgcctctgcctgtttgtggtgacgcctgtc
atggtggtgggcacagcctggatcttcctgcagggcgtttacaaccagccaccaccccag
ccttttcctggggacccctactcctacaacgtgcaggacaagcgcttcatctag

KEGG   Homo sapiens (human): 1145
Entry
1145              CDS       T01001                                 

Gene name
CHRNE, ACHRE, CMS1D, CMS1E, CMS2A, CMS4A, CMS4B, CMS4C, FCCMS, SCCMS
Definition
(RefSeq) cholinergic receptor nicotinic epsilon subunit
  KO
K04817  nicotinic acetylcholine receptor epsilon
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00770  Congenital myasthenic syndrome
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Cytisine: D07770
Gantacurium chloride: D04303
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Metocurine iodide: D00761
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Suxamethonium (DG00768): D00766<US> D02275<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1145 (CHRNE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1145 (CHRNE)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1145 (CHRNE)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb Vmethyltransf
Other DBs
NCBI-GeneID: 1145
NCBI-ProteinID: NP_000071
OMIM: 100725
HGNC: 1966
Ensembl: ENSG00000108556
Vega: OTTHUMG00000090778
Pharos: Q04844(Tclin)
UniProt: Q04844
LinkDB
Position
17p13.2
AA seq 493 aa
MARAPLGVLLLLGLLGRGVGKNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNL
ISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQF
GVAYDANVLVYEGGSVTWLPPAIYRSVCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFTF
AVDNDGKTINKIDIDTEAYTENGEWAIDFCPGVIRRHHGGATDGPGETDVIYSLIIRRKP
LFYVINIIVPCVLISGLVLLAYFLPAQAGGQKCTVSINVLLAQTVFLFLIAQKIPETSLS
VPLLGRFLIFVMVVATLIVMNCVIVLNVSQRTPTTHAMSPRLRHVLLELLPRLLGSPPPP
EAPRAASPPRRASSVGLLLRAEELILKKPRSELVFEGQRHRQGTWTAAFCQSLGAAAPEV
RCCVDAVNFVAESTRDQEATGEEVSDWVRMGNALDNICFWAALVLFSVGSSLIFLGAYFN
RVPDLPYAPCIQP
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggcaagggctccgcttggggtcctgctcctcttggggcttctcggcaggggtgtgggg
aagaacgaggaactgcgtctttatcaccatctcttcaacaactatgacccaggaagccgg
ccagtgcgggagcctgaggatactgtcaccatcagcctcaaggtcaccctgacgaatctc
atctcactgaatgaaaaagaggagactctcaccactagcgtctggattggaatcgattgg
caggattaccgactcaactacagcaaggacgactttgggggtatagaaaccctgcgagtc
ccttcagaactcgtgtggctgccagagattgtgctggaaaacaatattgatggccagttc
ggagtggcctacgacgccaacgtgctcgtctacgagggcggctccgtgacgtggctgcct
ccggccatctaccgcagcgtctgcgcagtggaggtcacctacttccccttcgattggcag
aactgttcgcttattttccgctctcagacgtacaatgccgaagaggtggagttcactttt
gccgtagacaacgacggcaagaccatcaacaagatcgacatcgacacagaggcctatact
gagaacggcgagtgggccatcgacttctgcccgggggtgatccgccgccaccacggtggc
gccaccgacggcccaggggagactgacgtcatctactcgctcatcatccgccggaagccg
ctcttctacgtcattaacatcatcgtgccctgtgtgctcatctcgggcctggtgctgctc
gcctacttcctgccggcgcaggccggcggccagaaatgcacggtctccatcaacgtcctg
ctcgcccagaccgtcttcttgttcctcattgcccagaaaatcccagagacttctctgagc
gtgccgctcctgggcaggttccttattttcgtcatggtggtcgccacgctcattgtcatg
aattgcgtcatcgtgctcaacgtgtcccagcggacgcccaccacccacgccatgtccccg
cggctgcgccacgttctcctggagctgctgccgcgcctcctgggctccccgccgccgccc
gaggccccccgggccgcctcgcccccaaggcgggcgtcgtcggtgggcttattgctccgc
gcggaggagctgatactgaaaaagccacggagcgagctcgtgtttgaggggcagaggcac
cggcaggggacctggacggctgccttctgccagagcctgggcgccgccgcccccgaggtc
cgctgctgtgtggatgccgtgaacttcgtggccgagagcacgagagatcaggaggccacc
ggcgaggaagtgtccgactgggtgcgcatggggaatgcccttgacaacatctgcttctgg
gccgctctggtgctcttcagcgtgggctccagcctcatcttcctcggggcctacttcaac
cgagtgcctgatctcccctacgcgccgtgtatccagccttag

KEGG   Homo sapiens (human): 1146
Entry
1146              CDS       T01001                                 

Gene name
CHRNG, ACHRG
Definition
(RefSeq) cholinergic receptor nicotinic gamma subunit
  KO
K04818  nicotinic acetylcholine receptor gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00986  Multiple pterygium syndrome
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Cytisine: D07770
Gantacurium chloride: D04303
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Metocurine iodide: D00761
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Suxamethonium (DG00768): D00766<US> D02275<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1146 (CHRNG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1146 (CHRNG)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1146 (CHRNG)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 1146
NCBI-ProteinID: NP_005190
OMIM: 100730
HGNC: 1967
Ensembl: ENSG00000196811
Vega: OTTHUMG00000153327
Pharos: P07510(Tclin)
UniProt: P07510 A0A6F7YAP6
LinkDB
Position
2q37.1
AA seq 517 aa
MHGGQGPLLLLLLLAVCLGAQGRNQEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLT
NLISLNEREEALTTNVWIEMQWCDYRLRWDPRDYEGLWVLRVPSTMVWRPDIVLENNVDG
VFEVALYCNVLVSPDGCIYWLPPAIFRSACSISVTYFPFDWQNCSLIFQSQTYSTNEIDL
QLSQEDGQTIEWIFIDPEAFTENGEWAIQHRPAKMLLDPAAPAQEAGHQKVVFYLLIQRK
PLFYVINIIAPCVLISSVAILIHFLPAKAGGQKCTVAINVLLAQTVFLFLVAKKVPETSQ
AVPLISKYLTFLLVVTILIVVNAVVVLNVSLRSPHTHSMARGVRKVFLRLLPQLLRMHVR
PLAPAAVQDTQSRLQNGSSGWSITTGEEVALCLPRSELLFQQWQRQGLVAAALEKLEKGP
ELGLSQFCGSLKQAAPAIQACVEACNLIACARHQQSHFDNGNEEWFLVGRVLDRVCFLAM
LSLFICGTAGIFLMAHYNRVPALPFPGDPRPYLPSPD
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgcatgggggccaggggccgctgctcctcctgctgctgctggctgtctgcctgggggcc
cagggccggaaccaggaggagcgcctgctcgcagacctgatgcaaaactacgaccccaac
ctgcggcccgcggaacgagactcggatgtggtcaatgtcagcctgaagctaaccctcacc
aacctcatctccctgaacgagcgagaggaagccctcaccaccaatgtctggatagagatg
cagtggtgcgactatcgcctgcgctgggatccgcgagactacgaaggcctgtgggtgctg
agggtgccgtccaccatggtgtggcggccggatatcgtgctggagaacaacgtggacggt
gtcttcgaggtggccctctactgcaatgtgctcgtgtcccctgacggctgtatctactgg
ctgccgcctgccatcttccgttccgcctgctctatctcagtcacctacttccccttcgac
tggcagaactgctcccttatcttccagtcccagacttacagcaccaatgagattgatctg
cagctgagtcaggaagatggccagaccatcgagtggattttcattgaccctgaggccttc
acagagaatggggagtgggccatccagcaccgaccagccaagatgctcctggacccagcg
gcgccagcccaggaagcaggccaccagaaggtggtgttctacctgctcatccagcgcaag
cccctcttctacgtcatcaacatcatcgccccctgtgtgctcatctcctctgtcgccatc
ctcatccacttccttcctgccaaggctgggggccagaagtgtaccgtcgccatcaacgtg
ctcctggcccagactgtcttcctcttccttgtggccaagaaggtgcctgaaacctcccag
gcggtgccactcatcagcaagtacctgaccttcctcctggtggtgaccatcctcattgtc
gtgaatgctgtggttgtgctcaatgtctccttgcggtctccacacacacactccatggcc
cgaggggtccgcaaggtgttcctgaggctcttgccccagctgctgaggatgcacgttcgc
ccgctggccccggcagctgtgcaggacacccagtcccggctacagaatggctcctcggga
tggtcgatcacaactggggaggaggtggccctctgcctgcctcgcagtgaactcctcttc
cagcagtggcagcggcaagggctggtggcggcagcgctggagaagctagagaaaggcccg
gagttagggctgagccagttctgtggcagcctgaagcaggctgccccagccatccaggcc
tgtgtggaagcctgcaacctcattgcctgtgcccggcaccagcagagtcactttgacaat
gggaatgaggagtggttcctggtgggccgagtgctggaccgcgtctgcttcctggccatg
ctctcgctcttcatctgtggcacagctggcatcttcctcatggcccactacaaccgggtg
ccggccctgccattccctggagatccacgcccctacctgccctcaccagactga

KEGG   Homo sapiens (human): 55584
Entry
55584             CDS       T01001                                 

Gene name
CHRNA9, HSA243342, NACHRA9
Definition
(RefSeq) cholinergic receptor nicotinic alpha 9 subunit
  KO
K04810  nicotinic acetylcholine receptor alpha-9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisine: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Rocuronium bromide: D00765<JP/US>
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    55584 (CHRNA9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    55584 (CHRNA9)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   55584 (CHRNA9)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb DUF5665
Other DBs
NCBI-GeneID: 55584
NCBI-ProteinID: NP_060051
OMIM: 605116
HGNC: 14079
Ensembl: ENSG00000174343
Vega: OTTHUMG00000099375
Pharos: Q9UGM1(Tbio)
UniProt: Q9UGM1
LinkDB
Structure
PDB: 
4UXU 4D01 6HY7 4UY2

Position
4p14
AA seq 479 aa
MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTL
QITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLY
NKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNG
NQVDIFNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSSFY
IVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTILLAMTVFQLMVAEIMPASENVPLIG
KYYIATMALITASTALTIMVMNIHFCGAEARPVPHWARVVILKYMSRVLFVYDVGESCLS
PHHSRERDHLTKVYSKLPESNLKAARNKDLSRKKDMNKRLKNDLGCQGKNPQEAESYCAQ
YKVLTRNIEYIAKCLKDHKATNSKGSEWKKVAKVIDRFFMWIFFIMVFVMTILIIARAD
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgaactggtcccattcctgcatctccttttgctggatctactttgctgcttccagactg
agagctgcagagacggcagatggaaaatatgctcagaagttgtttaatgacctttttgaa
gattattctaatgctcttcgtccagtggaagatacagataaagtcctgaatgtgaccctg
cagattacgctctctcagattaaggatatggatgaaagaaaccaaattctgactgcttat
ttgtggatccgccaaatctggcacgatgcctatctcacgtgggaccgagatcagtacgat
ggcctagactccatcaggatccccagtgacctcgtgtggaggccagacatcgtcttatat
aacaaggctgatgatgaatcttcagagcctgtgaacaccaatgtggtcctgcggtatgat
gggctgatcacctgggatgcaccggccatcaccaaaagctcctgtgtggtggatgtcacc
tacttcccttttgacaaccagcagtgcaacctgacttttggttcctggacctacaatggc
aatcaggtggacatattcaacgccttggacagcggagatctctctgacttcattgaagat
gtggaatgggaggtccatggcatgcccgctgtgaagaatgtgatctcctatggctgctgc
tctgagccttacccggatgtcacattcaccctccttctgaagaggaggtcctcgttctat
atcgtcaacctcctcatcccatgcgtcctcatatcttttctggctcctctgagtttttat
ctcccagcagcctccggagaaaaggtctccctgggagtgaccatcctgttggccatgact
gtatttcagctaatggtggcagaaatcatgccggcctcagaaaatgtgcccctgataggt
aaatactacatagccacgatggccctgatcacagcctccactgcgttgaccatcatggtg
atgaatatccacttctgtggggccgaggcccggccggtgccacactgggccagggtggtc
atcctgaaatacatgtccagggtcttgtttgtctatgatgtgggtgaaagctgcctcagc
ccgcaccacagtagagagcgggaccacctcacgaaagtttatagcaaactcccagagtct
aacctgaaagcagccaggaacaaagacctttccagaaagaaggacatgaacaaacgctta
aagaacgacctgggctgccagggtaagaaccctcaggaggccgagagttactgtgcacag
tacaaagtgctgacgaggaatattgagtacatcgccaagtgcctcaaagaccacaaggcc
accaattccaaggggagtgaatggaagaaggtggcgaaagtcatagaccgattcttcatg
tggatttttttcattatggtgtttgtgatgactattttgatcatagcaagagcggattag

KEGG   Homo sapiens (human): 57053
Entry
57053             CDS       T01001                                 

Gene name
CHRNA10
Definition
(RefSeq) cholinergic receptor nicotinic alpha 10 subunit
  KO
K04811  nicotinic acetylcholine receptor alpha-10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisine: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Rocuronium bromide: D00765<JP/US>
Trimetaphan (DG00251): D00612
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    57053 (CHRNA10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    57053 (CHRNA10)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   57053 (CHRNA10)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 57053
NCBI-ProteinID: NP_065135
OMIM: 606372
HGNC: 13800
Ensembl: ENSG00000129749
Vega: OTTHUMG00000011844
Pharos: Q9GZZ6(Tbio)
UniProt: Q9GZZ6
LinkDB
Position
11p15.4
AA seq 450 aa
MGLRSHHLSLGLLLLFLLPAECLGAEGRLALKLFRDLFANYTSALRPVADTDQTLNVTLE
VTLSQIIDMDERNQVLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYN
KADAQPPGSASTNVVLRHDGAVRWDAPAITRSSCRVDVAAFPFDAQHCGLTFGSWTHGGH
QLDVRPRGAAASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYV
CNLLLPCVLISLLAPLAFHLPADSGEKVSLGVTVLLALTVFQLLLAESMPPAESVPLIGK
YYMATMTMVTFSTALTILIMNLHYCGPSVRPVPAWARALLLGHLARGLCVRERGEPCGQS
RPPELSPSPQSPEGGAGPPAGPCHEPRCLCRQEALLHHVATIANTFRSHRAAQRCHEDWK
RLARVMDRFFLAIFFSMALVMSLLVLVQAL
NT seq 1353 nt   +upstreamnt  +downstreamnt
atggggctccggagccaccacctcagcctgggccttctgcttctgtttctactccctgca
gagtgcctgggagctgagggccggctggctctcaagctgttccgtgacctctttgccaac
tacacaagtgccctgagacctgtggcagacacagaccagactctgaatgtgaccctggag
gtgacactgtcccagatcatcgacatggatgaacggaaccaggtgctgaccctgtatctg
tggatacggcaggagtggacagatgcctacctacgatgggaccccaatgcctatggtggc
ctggatgccatccgcatccccagcagtcttgtgtggcggccagacatcgtactctataac
aaagccgacgcgcagcctccaggttccgccagcaccaacgtggtcctgcgccacgatggc
gccgtgcgctgggacgcgccggccatcacgcgcagctcgtgccgcgtggatgtagcagcc
ttcccgttcgacgcccagcactgcggcctgacgttcggctcctggactcacggcgggcac
caactggatgtgcggccgcgcggcgctgcagccagcctggcggacttcgtggagaacgtg
gagtggcgcgtgctgggcatgccggcgcggcggcgcgtgctcacctacggctgctgctcc
gagccctaccccgacgtcaccttcacgctgctgctgcgccgccgcgccgccgcctacgtg
tgcaacctgctgctgccctgcgtgctcatctcgctgcttgcgccgctcgccttccacctg
cctgccgactcaggcgagaaggtgtcgctgggcgtcaccgtgctgctggcgctcaccgtc
ttccagttgctgctggccgagagcatgccaccggccgagagcgtgccgctcatcgggaag
tactacatggccactatgaccatggtcacattctcaacagcactcaccatccttatcatg
aacctgcattactgtggtcccagtgtccgcccagtgccagcctgggctagggccctcctg
ctgggacacctggcacggggcctgtgcgtgcgggaaagaggggagccctgtgggcagtcc
aggccacctgagttatctcctagcccccagtcgcctgaaggaggggctggccccccagcg
ggcccttgccacgagccacgatgtctgtgccgccaggaagccctactgcaccacgtagcc
accattgccaataccttccgcagccaccgagctgcccagcgctgccatgaggactggaag
cgcctggcccgtgtgatggaccgcttcttcctggccatcttcttctccatggccctggtc
atgagcctcctggtgctggtgcaggccctgtga

KEGG   Homo sapiens (human): 8973
Entry
8973              CDS       T01001                                 

Gene name
CHRNA6, CHNRA6
Definition
(RefSeq) cholinergic receptor nicotinic alpha 6 subunit
  KO
K04808  nicotinic acetylcholine receptor alpha-6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa05033  Nicotine addiction
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisine: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Rocuronium bromide: D00765<JP/US>
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    8973 (CHRNA6)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    8973 (CHRNA6)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    8973 (CHRNA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    8973 (CHRNA6)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   8973 (CHRNA6)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF1286
Other DBs
NCBI-GeneID: 8973
NCBI-ProteinID: NP_004189
OMIM: 606888
HGNC: 15963
Ensembl: ENSG00000147434
Vega: OTTHUMG00000165275
Pharos: Q15825(Tchem)
UniProt: Q15825
LinkDB
Position
8p11.21
AA seq 494 aa
MLTSKGQGFLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQFIRPVENVSDPVT
VHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDI
VLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWT
YDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRRLP
MFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVV
PLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLPQVLLMRWPLD
KTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKECFHCHKSNELATSKRRLSHQPLQWVV
ENSEHSPEVEDVINSVQFIAENMKSHNETKEVEDDWKYVAMVVDRVFLWVFIIVCVFGTA
GLFLQPLLGNTGKS
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgctgaccagcaaggggcagggattccttcatgggggcttgtgtctctggctgtgtgtg
ttcacacctttctttaaaggctgtgtgggctgtgcaactgaggagaggctcttccacaaa
ctgttttctcattacaaccagttcatcaggcctgtggaaaacgtttccgaccctgtcacg
gtacactttgaagtggccatcacccagctggccaacgtggatgaagtaaaccagatcatg
gaaaccaatttgtggctgcgtcacatctggaatgattataaattgcgctgggatccaatg
gaatatgatggcattgagactcttcgcgttcctgcagataagatttggaagcccgacatt
gttctctataacaatgctgttggtgacttccaagtagaaggcaaaacaaaagctcttctt
aaatacaatggcatgataacctggactccaccagctatttttaagagttcctgccctatg
gatatcacctttttcccttttgatcatcaaaactgttccctaaaatttggttcctggacg
tatgacaaagctgaaattgatcttctaatcattggatcaaaagtggatatgaatgatttt
tgggaaaacagtgaatgggaaatcattgatgcctctggctacaaacatgacatcaaatac
aactgttgtgaagagatatacacagatataacctattctttctacattagaagattgccg
atgttttacacgattaatctgatcatcccttgtctctttatttcatttctaaccgtgttg
gtcttttaccttccttcggactgtggtgaaaaagtgacgctttgtatttcagtcctgctt
tctctgactgtgtttttgctggtcatcacagaaaccatcccatccacatctctggtggtc
ccactggtgggtgagtacctgctgttcaccatgatctttgtcacactgtccatcgtggtg
actgtgtttgtgttgaacatacactaccgcaccccaaccacgcacacaatgcccaggtgg
gtgaagacagttttcctgaagctgctgccccaggtcctgctgatgaggtggcctctggac
aagacaaggggcacaggctctgatgcagtgcccagaggccttgccaggaggcctgccaaa
ggcaagcttgcaagccatggggaacccagacatcttaaagaatgcttccattgtcacaaa
tcaaatgagcttgccacaagcaagagaagattaagtcatcagccattacagtgggtggtg
gaaaattcggagcactcgcctgaagttgaagatgtgattaacagtgttcagttcatagca
gaaaacatgaagagccacaatgaaaccaaggaggtagaagatgactggaaatacgtggcc
atggtggtggacagagtatttctttgggtatttataattgtctgtgtatttggaactgca
gggctatttctacagccactacttgggaacacaggaaaatcttaa

DBGET integrated database retrieval system