KEGG   Homo sapiens (human): 11346
Entry
11346             CDS       T01001                                 

Gene name
SYNPO
Definition
(RefSeq) synaptopodin
  KO
K21112  synaptopodin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    11346 (SYNPO)
SSDB
Motif
Pfam: Calsarcin
Other DBs
NCBI-GeneID: 11346
NCBI-ProteinID: NP_001159680
OMIM: 608155
HGNC: 30672
Ensembl: ENSG00000171992
Vega: OTTHUMG00000130078
Pharos: Q8N3V7(Tbio)
UniProt: Q8N3V7
LinkDB
Position
5q33.1
AA seq 929 aa
MLGPHLPPPPLAPSEGRPTPCAFQIPDGSYRCLALEAEESSGEEGLQGEVGPTDLEEDEG
VSRSGDDSACRVTQGTPQLPKALGIQPPSCSREEQGASQHDDRASQDWDVVKAGQMMTAS
PSPGPGPRVAQKPALGRSTSLTEKDLKEAKARSQQIAAQLTTPPSSNSRGVQLFNRRRQR
VNEFTLESHGQRGQKPSQESLRVLPSSLPGHAPGLSLSSTSLPEPGPPRHPSPQSPDRGV
PGHSMEGYSEEASLLRHLEKVASEEEEVPLVVYLKENAALLTANGLHLSQNREAQQSSPA
PPPAEVHSPAADVNQNLASPSATLTTPTSNSSHNPPATDVNQNPPATVVPQSLPLSSIQQ
NSSEAQLPSNGTGPASKPSTLCADGQPQAPAEEVRCSTLLIDKVSTPATTTSTFSREATL
IPSSRPPASDFMSSSLLIDIQPNTLVVSADQEMSGRAAATTPTKVYSEVHFTLAKPPSVV
NRTARPFGIQAPGGTSQMERSPMLERRHFGEKAPAPQPPSLPDRSPRPQRHIMSRSPMVE
RRMMGQRSPASERRPLGNFTAPPTYTETLSTAPLASWVRSPPSYSVLYPSSDPKSSHLKG
QAVPASKTGILEESMARRGSRKSMFTFVEKPKVTPNPDLLDLVQTADEKRRQRDQGEVGV
EEEPFALGAEASNFQQEPAPRDRASPAAAEEVVPEWASCLKSPRIQAKPKPKPNQNLSEA
SGKGAELYARRQSRMEKYVIESSSHTPELARCPSPTMSLPSSWKYPTNAPGAFRVASRSP
ARTPPASLYHGYLPENGVLRPEPTKQPPYQLRPSLFVLSPIKEPAKVSPRAASPAKPSSL
DLVPNLPKGALPPSPALPRPSRSSPGLYTSPGQDSLQPTAVSPPYGGDISPVSPSRAWSP
RAKQAPRPSFSTRNAGIEAQVWKPSFCFK
NT seq 2790 nt   +upstreamnt  +downstreamnt
atgctgggtcctcacctcccacctccgccccttgcacccagcgaagggaggcctaccccc
tgcgccttccagatccctgatggaagctacaggtgtctggctctggaagccgaggagagc
agcggtgaggagggcctgcagggagaggtggggcctaccgacctggaagaggatgagggg
gtcagcaggagtggggacgactctgcctgcagagtcacccaggggacaccgcagctgccc
aaagccctgggcatccaaccacccagctgctccagagaggaacaaggggcgtcccagcac
gacgacagggccagccaggactgggatgtagtgaaggccgggcagatgatgacagccagc
cccagccctggccctgggcccagagtggcccagaaaccagcgttgggccggagcactagc
ctcacggagaaggatctgaaagaagccaaggcgcggagccagcagattgcagcccagctg
accacccctcccagctccaattcccgtggcgtccagctcttcaacaggcgccggcagagg
gtgaacgagttcaccttggagagccacggccagaggggacagaagcccagccaggagtcc
ctcagagtgctcccttcaagcctcccaggccatgcaccggggctcagcctgagttccacc
tcgctgccggagccaggccctccacggcaccccagtccccagagccccgacagaggggtc
cctggccacagcatggaggggtactcagaggaggctagcttgctgcggcacctggagaag
gtggccagtgaggaggaagaggtaccactggtggtttatctaaaggagaatgcagcactg
ctgacagccaatgggctgcacctgtcccaaaaccgagaggcccagcagtcctcaccggcc
ccacctccagctgaggtccacagcccagctgcagatgtcaaccaaaaccttgcctcgccc
agtgccacgctcaccacaccaacttctaacagcagccacaatccgccagccaccgatgtc
aatcagaacccaccggcaactgttgtcccacagagcctgccactttctagcatccaacag
aattcctcagaggcccaactcccatctaatggcacagggcctgcttccaaacccagcacc
ctgtgtgctgatgggcaaccccaggcaccggctgaggaggtgagatgcagcacactccta
attgacaaggtatcaactccagctaccaccaccagcaccttctccagagaagctacgctc
atccccagctccaggcccccagcctcagatttcatgtccagctccctgctcattgacatc
cagcccaacaccctagtggtgtcagcagatcaagagatgtctgggcgagcagctgccacc
acgcccaccaaggtctacagtgaggtccacttcacactggccaagcccccatcagtggtc
aacaggacggccaggccttttgggatccaggcgccagggggcaccagccagatggagagg
agccccatgctagagagacgacattttggggagaaggccccggctccccagccccccagt
ttgccagacaggagcccccggccacagagacacataatgtcccgcagccccatggtggaa
aggaggatgatggggcagcgaagcccggcctcagagagacgccccttggggaacttcact
gcaccccccacctacactgagaccttgtccacagcccctctggcttcctgggtgaggtct
cctccctcatattctgtcctgtatcccagctccgaccccaagtcttctcatctgaagggc
caggcggttcctgccagcaagacgggcattctggaggagtcgatggcccgccggggcagc
cgcaaatccatgtttactttcgtggagaagcccaaggtgaccccgaatccagacttgctg
gatctggtacagacagcggatgagaagcggcggcagagggaccagggggaggtaggcgtg
gaggaggagcccttcgcactgggggccgaggcctccaacttccagcaggagccagcacct
cgtgacagggccagccccgcggcggcggaggaggtggtaccagagtgggcctcctgcctc
aagtcaccccgcatccaggccaagccgaagcccaaacccaaccagaacctctccgaggcc
tctgggaagggagctgagctctacgcccgccgccagtcacggatggagaaatatgtcatc
gagtcttcaagccacacgccagagctggcccgctgcccatcacctaccatgtccctgcct
tcctcctggaaataccccactaacgcccccggggccttccgagtggcatcccgaagccca
gcccggaccccgcctgcctccctctaccatggctacctgcctgagaacggggtcctgcgc
ccagagcccaccaagcagccgccataccagctgcgcccctcgctctttgtcctctcacct
atcaaggagcctgccaaggtctcaccaagagctgcctcgcccgccaagcccagctccttg
gacctggtgcccaacctgcccaagggggctctccctccatctcctgccctgcctcggccc
tcgcgctcctcaccgggcctctacacctcccccggccaggacagcctgcagcccactgcc
gtgagccctccttacggcggtgacatctcccccgtgtctccctccagggcgtggtctccc
cgagccaagcaggcccccaggccctccttctctacccggaacgccgggatcgaggctcag
gtgtggaagccttccttctgcttcaagtaa

DBGET integrated database retrieval system