KEGG   Homo sapiens (human): 1136
Entry
1136              CDS       T01001                                 

Gene name
CHRNA3, BAIPRCK, LNCR2, NACHRA3, PAOD2
Definition
(RefSeq) cholinergic receptor nicotinic alpha 3 subunit
  KO
K04805  nicotinic acetylcholine receptor alpha-3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisine: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Rocuronium bromide: D00765<JP/US>
Tebanicline tosylate: D06016
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1136 (CHRNA3)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1136 (CHRNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1136 (CHRNA3)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1136 (CHRNA3)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD FtsK_alpha
Other DBs
NCBI-GeneID: 1136
NCBI-ProteinID: NP_000734
OMIM: 118503
HGNC: 1957
Ensembl: ENSG00000080644
Vega: OTTHUMG00000143863
Pharos: P32297(Tclin)
UniProt: P32297
LinkDB
Position
15q25.1
AA seq 505 aa
MGSGPLSLPLALSPPRLLLLLLLSLLPVARASEAEHRLFERLFEDYNEIIRPVANVSDPV
IIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPD
IVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSW
SYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
PLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLV
IPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPT
SNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLT
RSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFL
WVFTLVCILGTAGLFLQPLMAREDA
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgggctctggcccgctctcgctgcccctggcgctgtcgccgccgcggctgctgctgctg
ctgctgctgtctctgctgccagtggccagggcctcagaggctgagcaccgtctatttgag
cggctgtttgaagattacaatgagatcatccggcctgtagccaacgtgtctgacccagtc
atcatccatttcgaggtgtccatgtctcagctggtgaaggtggatgaagtaaaccagatc
atggagaccaacctgtggctcaagcaaatctggaatgactacaagctgaaatggaacccc
tctgactatggtggggcagagttcatgcgtgtccctgcacagaagatctggaagccagac
attgtgctgtataacaatgctgttggggatttccaggtggacgacaagaccaaagcctta
ctcaagtacactggggaggtgacttggatacctccggccatctttaagagctcctgtaaa
atcgacgtgacctacttcccgtttgattaccaaaactgtaccatgaagttcggttcctgg
tcctacgataaggcgaaaatcgatctggtcctgatcggctcttccatgaacctcaaggac
tattgggagagcggcgagtgggccatcatcaaagccccaggctacaaacacgacatcaag
tacaactgctgcgaggagatctaccccgacatcacatactcgctgtacatccggcgcctg
cccttgttctacaccatcaacctcatcatcccctgcctgctcatctccttcctcactgtg
ctcgtcttctacctgccctccgactgcggtgagaaggtgaccctgtgcatttctgtcctc
ctctccctgacggtgtttctcctggtgatcactgagaccatcccttccacctcgctggtc
atccccctgattggagagtacctcctgttcaccatgatttttgtaaccttgtccatcgtc
atcaccgtcttcgtgctcaacgtgcactacagaaccccgacgacacacacaatgccctca
tgggtgaagactgtattcttgaacctgctccccagggtcatgttcatgaccaggccaaca
agcaacgagggcaacgctcagaagccgaggcccctctacggtgccgagctctcaaatctg
aattgcttcagccgcgcagagtccaaaggctgcaaggagggctacccctgccaggacggg
atgtgtggttactgccaccaccgcaggataaaaatctccaatttcagtgctaacctcacg
agaagctctagttctgaatctgttgatgctgtgctgtccctctctgctttgtcaccagaa
atcaaagaagccatccaaagtgtcaagtatattgctgaaaatatgaaagcacaaaatgaa
gccaaagagattcaagatgattggaagtatgttgccatggtgattgatcgtatttttctg
tgggttttcaccctggtgtgcattctagggacagcaggattgtttctgcaacccctgatg
gccagggaagatgcataa

KEGG   Homo sapiens (human): 1137
Entry
1137              CDS       T01001                                 

Gene name
CHRNA4, BFNC, EBN, EBN1, NACHR, NACHRA4, NACRA4
Definition
(RefSeq) cholinergic receptor nicotinic alpha 4 subunit
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa05033  Nicotine addiction
Disease
H00807  Nocturnal frontal lobe epilepsy
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Altinicline maleate: D02839
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisine: D07770
Dexmecamylamine (DG01378): D10111 D10112
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Ispronicline: D08935
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Pozanicline (DG01288): D09367 D09368
Rivanicline galactarate: D08987
Rocuronium bromide: D00765<JP/US>
Sofinicline (DG01286): D09382 D09383
Tebanicline tosylate: D06016
Tubocurarine (DG00767): D02207 D08655
Varenicline (DG00995): D06282<JP/US> D08669
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1137 (CHRNA4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1137 (CHRNA4)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    1137 (CHRNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1137 (CHRNA4)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1137 (CHRNA4)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD Blt1
Other DBs
NCBI-GeneID: 1137
NCBI-ProteinID: NP_000735
OMIM: 118504
HGNC: 1958
Ensembl: ENSG00000101204
Vega: OTTHUMG00000033080
Pharos: P43681(Tclin)
UniProt: P43681 Q59FV0 B4DK78
LinkDB
Structure
PDB: 
6CNJ 6CNK 5KXI 2LLY

Position
20q13.33
AA seq 627 aa
MELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKWSRPVANISD
VVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWR
PDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFG
SWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIR
RLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTS
LVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLMKR
PSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGP
SCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEG
GVRCRSRSIQYCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSV
SPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDR
IFLWMFIIVCLLGTVGLFLPPWLAGMI
NT seq 1884 nt   +upstreamnt  +downstreamnt
atggagctagggggccccggagcgccgcggctgctgccgccgctgctgctgcttctgggg
accggcctcctgcgcgccagcagccatgtggagacccgggcccacgccgaggagcggctc
ctgaagaaactcttctccggttacaacaagtggtcccgacccgtggccaacatctcggac
gtggtcctcgtccgcttcggcctgtccatcgctcagctcattgacgtggatgagaagaac
cagatgatgaccacgaacgtatgggtgaagcaggagtggcacgactacaagctgcgctgg
gacccagctgactatgagaatgtcacctccatccgcatcccctccgagctcatctggcgg
ccggacatcgtcctctacaacaatgctgacggggacttcgcggtcacccacctgaccaag
gcccacctgttccatgacgggcgggtgcagtggactcccccggccatttacaagagctcc
tgcagcatcgacgtcaccttcttccccttcgaccagcagaactgcaccatgaaattcggc
tcctggacctacgacaaggccaagatcgacctggtgaacatgcacagccgcgtggaccag
ctggacttctgggagagtggcgagtgggtcatcgtggatgccgtgggcacctacaacacc
aggaagtacgagtgctgtgccgagatctacccggacatcacctatgccttcgtcatccgg
cggctgccgctcttctacaccatcaacctcatcatcccctgcctgctcatctcctgcctc
accgtgctggtcttctacctgccctccgagtgtggcgagaagatcacgctgtgcatctcc
gtgctgctgtcgctcaccgtcttcctgctgctcatcaccgagatcatcccgtccacctca
ctggtcatcccactcatcggcgagtacctgctgttcaccatgatcttcgtcaccctgtcc
atcgtcatcacggtcttcgtgctcaacgtgcaccaccgctcgccacgcacgcacaccatg
cccacctgggtacgcagggtcttcctggacatcgtgccacgcctgctcctcatgaagcgg
ccgtccgtggtcaaggacaattgccggcggctcatcgagtccatgcataagatggccagt
gccccgcgcttctggcccgagccagaaggggagccccctgccacgagcggcacccagagc
ctgcacccgccctcaccgtccttctgtgtccccctggatgtgccggctgagcctgggcct
tcctgcaagtcaccctccgaccagctccctcctcagcagcccctggaagctgagaaagcc
agcccccacccctcgcctggaccctgccgcccgccccacggcacccaggcaccagggctg
gccaaagccaggtccctcagcgtccagcacatgtccagccctggcgaagcggtggaaggc
ggcgtccggtgccggtctcggagcatccagtactgtgttccccgagacgatgccgccccc
gaggcagatggccaggctgccggcgccctggcctctcgcaacacccactcggctgagctc
ccacccccagaccagccctctccgtgcaaatgcacatgcaagaaggagccctcttcggtg
tccccgagcgccacggtcaagacccgcagcaccaaagcgccgcccccgcacctgcccctg
tcgccggccctgacccgggcggtggagggcgtccagtacattgcagaccacctgaaggcc
gaagacacagacttctcggtgaaggaggactggaagtacgtggccatggtcatcgaccgc
atcttcctctggatgttcatcatcgtctgcctgctggggacggtgggcctcttcctgccg
ccctggctggctggcatgatctag

KEGG   Homo sapiens (human): 1139
Entry
1139              CDS       T01001                                 

Gene name
CHRNA7, CHRNA7-2, NACHRA7
Definition
(RefSeq) cholinergic receptor nicotinic alpha 7 subunit
  KO
K04809  nicotinic acetylcholine receptor alpha-7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05033  Nicotine addiction
hsa05204  Chemical carcinogenesis
Network
nt06418  Oxidative phosphorylation
nt06419  Microtubule-based transport
nt06460  Alzheimer disease
  Element
N00997  Mutation-caused aberrant Abeta to electron transfer in Complex I
N01018  Mutation-caused aberrant Abeta to anterograde axonal transport
Disease
H01877  Chromosome 15q13.3 microdeletion syndrome
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Atracurium (DG00771): D00758<US>
Bradanicline (DG01849): D10613 D10693
Cisatracurium: D00759<US>
Cytisine: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Encenicline (DG01852): D10626 D10702 D10789
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Rocuronium bromide: D00765<JP/US>
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    1139 (CHRNA7)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1139 (CHRNA7)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1139 (CHRNA7)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    1139 (CHRNA7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1139 (CHRNA7)
   05022 Pathways of neurodegeneration - multiple diseases
    1139 (CHRNA7)
  09165 Substance dependence
   05033 Nicotine addiction
    1139 (CHRNA7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1139 (CHRNA7)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1139 (CHRNA7)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb SUR7
Other DBs
NCBI-GeneID: 1139
NCBI-ProteinID: NP_000737
OMIM: 118511
HGNC: 1960
Ensembl: ENSG00000175344
Vega: OTTHUMG00000129285
UniProt: P36544
LinkDB
Structure
PDB: 
2MAW

Position
15q13.3
AA seq 502 aa
MRCSPGGVWLALAASLLHVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLL
QIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADE
RFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDL
QMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIP
CVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST
MIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK
QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHL
LHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTI
ICTIGILMSAPNFVEAVSKDFA
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgcgctgctcgccgggaggcgtctggctggcgctggccgcgtcgctcctgcacgtgtcc
ctgcaaggcgagttccagaggaagctttacaaggagctggtcaagaactacaatcccttg
gagaggcccgtggccaatgactcgcaaccactcaccgtctacttctccctgagcctcctg
cagatcatggacgtggatgagaagaaccaagttttaaccaccaacatttggctgcaaatg
tcttggacagatcactatttacagtggaatgtgtcagaatatccaggggtgaagactgtt
cgtttcccagatggccagatttggaaaccagacattcttctctataacagtgctgatgag
cgctttgacgccacattccacactaacgtgttggtgaattcttctgggcattgccagtac
ctgcctccaggcatattcaagagttcctgctacatcgatgtacgctggtttccctttgat
gtgcagcactgcaaactgaagtttgggtcctggtcttacggaggctggtccttggatctg
cagatgcaggaggcagatatcagtggctatatccccaatggagaatgggacctagtggga
atccccggcaagaggagtgaaaggttctatgagtgctgcaaagagccctaccccgatgtc
accttcacagtgaccatgcgccgcaggacgctctactatggcctcaacctgctgatcccc
tgtgtgctcatctccgccctcgccctgctggtgttcctgcttcctgcagattccggggag
aagatttccctggggataacagtcttactctctcttaccgtcttcatgctgctcgtggct
gagatcatgcccgcaacatccgattcggtaccattgatagcccagtacttcgccagcacc
atgatcatcgtgggcctctcggtggtggtgacagtgatcgtgctgcagtaccaccaccac
gaccccgacgggggcaagatgcccaagtggaccagagtcatccttctgaactggtgcgcg
tggttcctgcgaatgaagaggcccggggaggacaaggtgcgcccggcctgccagcacaag
cagcggcgctgcagcctggccagtgtggagatgagcgccgtggcgccgccgcccgccagc
aacgggaacctgctgtacatcggcttccgcggcctggacggcgtgcactgtgtcccgacc
cccgactctggggtagtgtgtggccgcatggcctgctcccccacgcacgatgagcacctc
ctgcacggcgggcaaccccccgagggggacccggacttggccaagatcctggaggaggtc
cgctacattgccaaccgcttccgctgccaggacgaaagcgaggcggtctgcagcgagtgg
aagttcgccgcctgtgtggtggaccgcctgtgcctcatggccttctcggtcttcaccatc
atctgcaccatcggcatcctgatgtcggctcccaacttcgtggaggccgtgtccaaagac
tttgcgtaa

KEGG   Homo sapiens (human): 1141
Entry
1141              CDS       T01001                                 

Gene name
CHRNB2, EFNL3, nAChRB2
Definition
(RefSeq) cholinergic receptor nicotinic beta 2 subunit
  KO
K04813  nicotinic acetylcholine receptor beta-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa05033  Nicotine addiction
Disease
H00807  Nocturnal frontal lobe epilepsy
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Altinicline maleate: D02839
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisine: D07770
Dexmecamylamine (DG01378): D10111 D10112
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Ispronicline: D08935
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Pozanicline (DG01288): D09367 D09368
Rivanicline galactarate: D08987
Rocuronium bromide: D00765<JP/US>
Sofinicline (DG01286): D09382 D09383
Tebanicline tosylate: D06016
Tubocurarine (DG00767): D02207 D08655
Varenicline (DG00995): D06282<JP/US> D08669
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1141 (CHRNB2)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1141 (CHRNB2)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    1141 (CHRNB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1141 (CHRNB2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1141 (CHRNB2)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Other DBs
NCBI-GeneID: 1141
NCBI-ProteinID: NP_000739
OMIM: 118507
HGNC: 1962
Ensembl: ENSG00000160716
Vega: OTTHUMG00000037262
Pharos: P17787(Tclin)
UniProt: P17787 Q5SXY3
LinkDB
Structure
PDB: 
6CNJ 6CNK 5KXI 2LM2 2KSR

Position
1q21.3
AA seq 502 aa
MARRCGPVALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQL
MVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLY
NNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDR
TEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRKPLFYTIN
LIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKY
LMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPRHHCARQR
LRLRRRQREREGAGALFFREAPGADSCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPC
GCGLREAVDGVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQ
PLFQNYTTTTFLHSDHSAPSSK
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggcccggcgctgcggccccgtggcgctgctccttggcttcggcctcctccggctgtgc
tcaggggtgtggggtacggatacagaggagcggctggtggagcatctcctggatccttcc
cgctacaacaagcttatccgcccagccaccaatggctctgagctggtgacagtacagctt
atggtgtcactggcccagctcatcagtgtgcatgagcgggagcagatcatgaccaccaat
gtctggctgacccaggagtgggaagattatcgcctcacctggaagcctgaagagtttgac
aacatgaagaaagttcggctcccttccaaacacatctggctcccagatgtggtcctgtac
aacaatgctgacggcatgtacgaggtgtccttctattccaatgccgtggtctcctatgat
ggcagcatcttctggctgccgcctgccatctacaagagcgcatgcaagattgaagtaaag
cacttcccatttgaccagcagaactgcaccatgaagttccgttcgtggacctacgaccgc
acagagatcgacttggtgctgaagagtgaggtggccagcctggacgacttcacacctagt
ggtgagtgggacatcgtggcgctgccgggccggcgcaacgagaaccccgacgactctacg
tacgtggacatcacgtatgacttcatcattcgccgcaagccgctcttctacaccatcaac
ctcatcatcccctgtgtgctcatcacctcgctagccatccttgtcttctacctgccatcc
gactgtggcgagaagatgacgttgtgcatctcagtgctgctggcgctcacggtcttcctg
ctgctcatctccaagatcgtgcctcccacctccctcgacgtgccgctcgtcggcaagtac
ctcatgttcaccatggtgcttgtcaccttctccatcgtcaccagcgtgtgcgtgctcaac
gtgcaccaccgctcgcccaccacgcacaccatggcgccctgggtgaaggtcgtcttcctg
gagaagctgcccgcgctgctcttcatgcagcagccacgccatcattgcgcccgtcagcgc
ctgcgcctgcggcgacgccagcgtgagcgcgagggcgctggagccctcttcttccgcgaa
gccccaggggccgactcctgcacgtgcttcgtcaaccgcgcgtcggtgcaggggttggcc
ggggccttcggggctgagcctgcaccagtggcgggccccgggcgctcaggggagccgtgt
ggctgtggcctccgggaggcggtggacggcgtgcgcttcatcgcagaccacatgcggagc
gaggacgatgaccagagcgtgagtgaggactggaagtacgtcgccatggtgatcgaccgc
ctcttcctctggatctttgtctttgtctgtgtctttggcaccatcggcatgttcctgcag
cctctcttccagaactacaccaccaccaccttcctccactcagaccactcagcccccagc
tccaagtga

KEGG   Homo sapiens (human): 1143
Entry
1143              CDS       T01001                                 

Gene name
CHRNB4
Definition
(RefSeq) cholinergic receptor nicotinic beta 4 subunit
  KO
K04815  nicotinic acetylcholine receptor beta-4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisine: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Rocuronium bromide: D00765<JP/US>
Tebanicline tosylate: D06016
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1143 (CHRNB4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1143 (CHRNB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1143 (CHRNB4)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1143 (CHRNB4)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Other DBs
NCBI-GeneID: 1143
NCBI-ProteinID: NP_000741
OMIM: 118509
HGNC: 1964
Ensembl: ENSG00000117971
Vega: OTTHUMG00000143860
Pharos: P30926(Tclin)
UniProt: P30926
LinkDB
Position
15q25.1
AA seq 498 aa
MRRAPSLVLFFLVALCGRGNCRVANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIKLQL
SLAQLISVNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNN
ADGTYEVSVYTNLIVRSNGSVLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYDHTE
IDMVLMTPTASMDDFTPSGEWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLI
IPCVLTTLLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDVPLIGKYLM
FTMVLVTFSIVTSVCVLNVHHRSPSTHTMAPWVKRCFLHKLPTFLFMKRPGPDSSPARAF
PPSKSCVTKPEATATSTSPSNFYGNSMYFVNPASAASKSPAGSTPVAIPRDFWLRSSGRF
RQDVQEALEGVSFIAQHMKNDDEDQSVVEDWKYVAMVVDRLFLWVFMFVCVLGTVGLFLP
PLFQTHAASEGPYAAQRD
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgaggcgcgcgccttccctggtccttttcttcctggtcgccctttgcgggcgcgggaac
tgccgcgtggccaatgcggaggaaaagctgatggacgaccttctgaacaaaacccgttac
aataacctgatccgcccagccaccagctcctcacagctcatctccatcaagctgcagctc
tccctggcccagcttatcagcgtgaatgagcgagagcagatcatgaccaccaatgtctgg
ctgaaacaggaatggactgattaccgcctgacctggaacagctcccgctacgagggtgtg
aacatcctgaggatccctgcaaagcgcatctggttgcctgacatcgtgctttacaacaac
gccgacgggacctatgaggtgtctgtctacaccaacttgatagtccggtccaacggcagc
gtcctgtggctgccccctgccatctacaagagcgcctgcaagattgaggtgaagtacttt
cccttcgaccagcagaactgcaccctcaagttccgctcctggacctatgaccacacggag
atagacatggtcctcatgacgcccacagccagcatggatgactttactcccagtggtgag
tgggacatagtggccctcccagggagaaggacagtgaacccacaagaccccagctacgtg
gacgtgacttacgacttcatcatcaagcgcaagcctctgttctacaccatcaacctcatc
atcccctgcgtgctcaccaccttgctggccatcctcgtcttctacctgccatccgactgc
ggcgagaagatgacactgtgcatctcagtgctgctggcactgacattcttcctgctgctc
atctccaagatcgtgccacccacctccctcgatgtgcctctcatcggcaagtacctcatg
ttcaccatggtgctggtcaccttctccatcgtcaccagcgtctgtgtgctcaatgtgcac
caccgctcgcccagcacccacaccatggcaccctgggtcaagcgctgcttcctgcacaag
ctgcctaccttcctcttcatgaagcgccctggccccgacagcagcccggccagagccttc
ccgcccagcaagtcatgcgtgaccaagcccgaggccaccgccacctccaccagcccctcc
aacttctatgggaactccatgtactttgtgaaccccgcctctgcagcttccaagtctcca
gccggctctaccccggtggctatccccagggatttctggctgcggtcctctgggaggttc
cgacaggatgtgcaggaggcattagaaggtgtcagcttcatcgcccagcacatgaagaat
gacgatgaagaccagagtgtcgttgaggactggaagtacgtggctatggtggtggaccgg
ctgttcctgtgggtgttcatgtttgtgtgcgtcctgggcactgtggggctcttcctaccg
cccctcttccagacccatgcagcttctgaggggccctacgctgcccagcgtgactga

KEGG   Homo sapiens (human): 8973
Entry
8973              CDS       T01001                                 

Gene name
CHRNA6, CHNRA6
Definition
(RefSeq) cholinergic receptor nicotinic alpha 6 subunit
  KO
K04808  nicotinic acetylcholine receptor alpha-6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa05033  Nicotine addiction
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisine: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Rocuronium bromide: D00765<JP/US>
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    8973 (CHRNA6)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    8973 (CHRNA6)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    8973 (CHRNA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    8973 (CHRNA6)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   8973 (CHRNA6)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF1286
Other DBs
NCBI-GeneID: 8973
NCBI-ProteinID: NP_004189
OMIM: 606888
HGNC: 15963
Ensembl: ENSG00000147434
Vega: OTTHUMG00000165275
Pharos: Q15825(Tchem)
UniProt: Q15825
LinkDB
Position
8p11.21
AA seq 494 aa
MLTSKGQGFLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQFIRPVENVSDPVT
VHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDI
VLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWT
YDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRRLP
MFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVV
PLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLPQVLLMRWPLD
KTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKECFHCHKSNELATSKRRLSHQPLQWVV
ENSEHSPEVEDVINSVQFIAENMKSHNETKEVEDDWKYVAMVVDRVFLWVFIIVCVFGTA
GLFLQPLLGNTGKS
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgctgaccagcaaggggcagggattccttcatgggggcttgtgtctctggctgtgtgtg
ttcacacctttctttaaaggctgtgtgggctgtgcaactgaggagaggctcttccacaaa
ctgttttctcattacaaccagttcatcaggcctgtggaaaacgtttccgaccctgtcacg
gtacactttgaagtggccatcacccagctggccaacgtggatgaagtaaaccagatcatg
gaaaccaatttgtggctgcgtcacatctggaatgattataaattgcgctgggatccaatg
gaatatgatggcattgagactcttcgcgttcctgcagataagatttggaagcccgacatt
gttctctataacaatgctgttggtgacttccaagtagaaggcaaaacaaaagctcttctt
aaatacaatggcatgataacctggactccaccagctatttttaagagttcctgccctatg
gatatcacctttttcccttttgatcatcaaaactgttccctaaaatttggttcctggacg
tatgacaaagctgaaattgatcttctaatcattggatcaaaagtggatatgaatgatttt
tgggaaaacagtgaatgggaaatcattgatgcctctggctacaaacatgacatcaaatac
aactgttgtgaagagatatacacagatataacctattctttctacattagaagattgccg
atgttttacacgattaatctgatcatcccttgtctctttatttcatttctaaccgtgttg
gtcttttaccttccttcggactgtggtgaaaaagtgacgctttgtatttcagtcctgctt
tctctgactgtgtttttgctggtcatcacagaaaccatcccatccacatctctggtggtc
ccactggtgggtgagtacctgctgttcaccatgatctttgtcacactgtccatcgtggtg
actgtgtttgtgttgaacatacactaccgcaccccaaccacgcacacaatgcccaggtgg
gtgaagacagttttcctgaagctgctgccccaggtcctgctgatgaggtggcctctggac
aagacaaggggcacaggctctgatgcagtgcccagaggccttgccaggaggcctgccaaa
ggcaagcttgcaagccatggggaacccagacatcttaaagaatgcttccattgtcacaaa
tcaaatgagcttgccacaagcaagagaagattaagtcatcagccattacagtgggtggtg
gaaaattcggagcactcgcctgaagttgaagatgtgattaacagtgttcagttcatagca
gaaaacatgaagagccacaatgaaaccaaggaggtagaagatgactggaaatacgtggcc
atggtggtggacagagtatttctttgggtatttataattgtctgtgtatttggaactgca
gggctatttctacagccactacttgggaacacaggaaaatcttaa

DBGET integrated database retrieval system