KEGG   Homo sapiens (human): 113878Help
Entry
113878            CDS       T01001                                 

Gene name
DTX2, RNF58
Definition
(RefSeq) deltex E3 ubiquitin ligase 2
  KO
K06058  deltex [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    113878 (DTX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    113878 (DTX2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     113878 (DTX2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    113878 (DTX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DTC WWE zf-C3HC4 zf-rbx1 zf-RING_2 zf-ANAPC11 zf-RING_11 zf-RING_5 zf-RING_UBOX zf-UDP
Motif
Other DBs
NCBI-GeneID: 113878
NCBI-ProteinID: NP_001096064
OMIM: 613141
HGNC: 15973
Ensembl: ENSG00000091073
Vega: OTTHUMG00000162594
Pharos: Q86UW9(Tbio)
UniProt: Q86UW9
LinkDB All DBs
Position
7q11.23
AA seq 622 aa AA seqDB search
MAMAPSPSLVQVYTSPAAVAVWEWQDGLGTWHPYSATVCSFIEQQFVQQKGQRFGLGSLA
HSIPLGQADPSLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQHSAPGRGVVWEWLSDDGS
WTAYEASVCDYLEQQVARGNQLVDLAPLGYNYTVNYTTHTQTNKTSSFCRSVRRQAGPPY
PVTTIIAPPGHTGVACSCHQCLSGSRTGPVSGRYRHSMTNLPAYPVPQHPPHRTASVFGT
HQAFAPYNKPSLSGARSAPRLNTTNAWGAAPPSLGSQPLYRSSLSHLGPQHLPPGSSTSG
AVSASLPSGPSSSPGSVPATVPMQMPKPSRVQQALAGMTSVLMSAIGLPVCLSRAPQPTS
PPASRLASKSHGSVKRLRKMSVKGATPKPEPEPEQVIKNYTEELKVPPDEDCIICMEKLS
TASGYSDVTDSKAIGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKT
GTQPQGKMEVLRFQMSLPGHEDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLP
DNAQGRKVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMDRNITGHGYPDPN
YLQNVLAELAAQGVTEDCLEQQ
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggccatggccccaagcccttccctggtgcaggtgtacaccagccccgcggctgtggcc
gtgtgggaatggcaggacgggctgggcacctggcacccctacagtgccaccgtctgcagc
ttcatcgagcagcagtttgtccagcagaagggccaacgttttgggcttgggagcctggcc
cacagcatccccttgggccaggcagacccctcgctggccccttacattattgacctcccc
agctggacccagttccgccaggacaccggcaccatgcgggctgtgcggagacacctgttc
ccccagcactcagcccctggccgaggtgtcgtctgggagtggctgagcgacgatggctcc
tggactgcctatgaagccagcgtctgtgactatctggagcagcaggtggccaggggcaac
cagctcgtggacttggcccccctggggtacaactacactgtcaactacaccacccacacg
cagaccaacaagacttccagcttctgccgcagcgtgcggcgccaagcagggccgccttac
ccggtgaccaccatcatcgctccgccgggccacacaggcgtcgcctgctcttgccaccag
tgcctcagtggcagcagaactggccccgtgtcaggccgctaccgccactccatgaccaac
ctccctgcataccccgtcccccagcaccccccacacaggaccgcttctgtgtttgggacc
caccaggcctttgcaccgtacaacaaaccctcactctccggggcccggtctgcgcccagg
ctgaacaccaccaacgcctggggcgcagctcctccttccctggggagccagcccctctac
cgctccagcctctcccacctgggaccgcagcacctgcccccaggatcctccacctccggt
gcagtcagtgcctccctccccagcggtccctcaagcagcccagggagcgtccctgccact
gtgcccatgcagatgccaaagcccagcagagtccagcaggcgctcgcaggcatgacgagt
gttctgatgtcagccattggactccctgtgtgtcttagccgcgcaccccagcccaccagc
cctcccgcctcccgtctggcttccaaaagtcacggctcagttaagagattgaggaaaatg
tccgtgaaaggagcgaccccgaagccagagccagagccagagcaggtcataaaaaactac
acggaagagctgaaagtgcccccagatgaggactgcatcatctgcatggagaagctgtcc
acagcgtctggatacagcgatgtgactgacagcaaggcaatcgggtccctagctgtgggc
cacctcaccaagtgcagccatgccttccacctgctgtgcctcctggccatgtactgcaac
ggcaataaggatggaagtctgcagtgtccctcctgcaaaaccatctatggagagaagacg
gggacccagccccagggaaagatggaggtattacggttccagatgtcgctccccggccac
gaggactgcgggaccatcctcatagtttacagcattccccatggtatccagggccctgag
caccccaatcccggaaagccgttcactgccagagggtttccccgccagtgctaccttcca
gacaacgcccagggccgcaaggtcctagagctcctgaaggtggcctggaagaggcggctc
atcttcacagtgggcacgtccagcaccacgggtgagacggacaccgtggtatggaacgag
atccaccacaagacagagatggaccgcaacattacgggccacggctatcccgaccccaac
tacctgcagaacgtgctggctgagctggctgcccagggggtgaccgaggactgcctggag
cagcagtga

KEGG   Homo sapiens (human): 151636Help
Entry
151636            CDS       T01001                                 

Gene name
DTX3L, BBAP, RNF143
Definition
(RefSeq) deltex E3 ubiquitin ligase 3L
  KO
K06058  deltex [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    151636 (DTX3L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    151636 (DTX3L)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     151636 (DTX3L)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    151636 (DTX3L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DTC zf-C3HC4_2 zf-RING_2 zf-C3HC4_3 zf-C3HC4 zf-RING_5 zf-RING_4 zf-RING_6 zf-rbx1 zf-RING_UBOX zf-RING_10 Prok-RING_4 zf-RING_11 zf-UDP
Motif
Other DBs
NCBI-GeneID: 151636
NCBI-ProteinID: NP_612144
OMIM: 613143
HGNC: 30323
Ensembl: ENSG00000163840
Vega: OTTHUMG00000159524
Pharos: Q8TDB6(Tbio)
UniProt: Q8TDB6
LinkDB All DBs
Structure
PDB: 

Position
3q21.1
AA seq 740 aa AA seqDB search
MASHLRPPSPLLVRVYKSGPRVRRKLESYFQSSKSSGGGECTVSTQEHEAPGTFRVEFSE
RAAKERVLKKGEHQILVDEKPVPIFLVPTENSIKKNTRPQISSLTQSQAETPSGDMHQHE
GHIPNAVDSCLQKIFLTVTADLNCNLFSKEQRAYITTLCPSIRKMEGHDGIEKVCGDFQD
IERIHQFLSEQFLESEQKQQFSPSMTERKPLSQQERDSCISPSEPETKAEQKSNYFEVPL
PYFEYFKYICPDKINSIEKRFGVNIEIQESSPNMVCLDFTSSRSGDLEAARESFASEFQK
NTEPLKQECVSLADSKQANKFKQELNHQFTKLLIKEKGGELTLLGTQDDISAAKQKISEA
FVKIPVKLFAANYMMNVIEVDSAHYKLLETELLQEISEIEKRYDICSKVSEKGQKTCILF
ESKDRQVDLSVHAYASFIDAFQHASCQLMREVLLLKSLGKERKHLHQTKFADDFRKRHPN
VHFVLNQESMTLTGLPNHLAKAKQYVLKGGGMSSLAGKKLKEGHETPMDIDSDDSKAASP
PLKGSVSSEASELDKKEKGICVICMDTISNKKVLPKCKHEFCAPCINKAMSYKPICPTCQ
TSYGIQKGNQPEGSMVFTVSRDSLPGYESFGTIVITYSMKAGIQTEEHPNPGKRYPGIQR
TAYLPDNKEGRKVLKLLYRAFDQKLIFTVGYSRVLGVSDVITWNDIHHKTSRFGGPEMYG
YPDPSYLKRVKEELKAKGIE
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccacctgcgcccgccgtccccgctcctcgtgcgggtgtacaagtccggcccc
cgagtacgaaggaagctggagagctacttccagagctctaagtcctcgggcggcggggag
tgcacggtcagcacccaggaacacgaagccccgggcaccttccgggtggagttcagtgaa
agggcagctaaggagagagtgttgaaaaaaggagagcaccaaatacttgttgacgaaaaa
cctgtgcccattttcctggtacccactgaaaattcaataaagaagaacacgagacctcaa
atttcttcactgacacaatcacaagcagaaacaccgtctggtgatatgcatcaacatgaa
ggacatattcctaatgctgtggattcctgtctccaaaagatctttcttactgtaacagct
gacctgaactgtaacctgttctccaaagagcagagggcatacataaccacactgtgccct
agtatcagaaaaatggaaggtcacgatggaattgagaaggtgtgtggtgacttccaagac
attgaaagaatacatcaatttttgagtgagcagttcctggaaagtgagcagaaacaacaa
ttttccccttcaatgacagagaggaagccactcagtcagcaggagagggacagctgcatt
tctccttctgaaccagaaaccaaggcagaacaaaaaagcaactattttgaagttcccttg
ccttactttgaatactttaaatatatctgtcctgataaaatcaactcaatagagaaaaga
tttggtgtaaacattgaaatccaggagagttctccaaatatggtctgtttagatttcacc
tcaagtcgatcaggtgacctggaagcagctcgtgagtcttttgctagtgaatttcagaag
aacacagaacctctgaagcaagaatgtgtctctttagcagacagtaagcaggcaaataaa
ttcaaacaggaattgaatcaccagtttacaaagctccttataaaggagaaaggaggcgaa
ttaactctccttgggacccaagatgacatttcagctgccaaacaaaaaatctctgaagct
tttgtcaagatacctgtgaaactatttgctgccaattacatgatgaatgtaattgaggtt
gatagtgcccactataaacttttagaaactgaattactacaggagatatcagagatcgaa
aaaaggtatgacatttgcagcaaggtttctgagaaaggtcagaaaacctgcattctgttt
gaatccaaggacaggcaggtagatctatctgtgcatgcttatgcaagtttcatcgatgcc
tttcaacatgcctcatgtcagttgatgagagaagttcttttactgaagtctttgggcaag
gagagaaagcacttacatcagaccaagtttgctgatgactttagaaaaagacatccaaat
gtacactttgtgctaaatcaagagtcaatgactttgactggtttgccaaatcaccttgca
aaggcgaagcagtatgttctaaaaggaggaggaatgtcttcattggctggaaagaaattg
aaagagggtcatgaaacaccgatggacattgatagcgatgattccaaagcagcttctccg
ccactcaagggctctgtgagttctgaggcctcagaactggacaagaaggaaaagggcatc
tgtgtcatctgtatggacaccattagtaacaaaaaagtgctaccaaagtgcaagcatgaa
ttctgcgccccttgtatcaacaaagccatgtcatataagccaatctgtcccacatgccag
acttcctatggtattcagaaaggaaatcagccagagggaagcatggttttcactgtttca
agagactcacttccaggttatgagtcctttggcaccattgtgattacttattctatgaaa
gcaggcatacaaacagaagaacacccaaacccaggaaagagataccctggaatacagcga
actgcatacttgcctgataataaggaaggaaggaaggttttgaaactgctttatagggcc
tttgaccaaaagctgatttttacagtggggtactctcgcgtattaggagtctcagatgtc
atcacttggaatgatattcaccacaaaacatcccggtttggaggaccagaaatgtatggc
tatcctgatccttcttacctgaaacgtgtcaaagaggagctgaaagccaaaggaattgag
taa

KEGG   Homo sapiens (human): 1840Help
Entry
1840              CDS       T01001                                 

Gene name
DTX1, RNF140, hDx-1
Definition
(RefSeq) deltex E3 ubiquitin ligase 1
  KO
K06058  deltex [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    1840 (DTX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    1840 (DTX1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     1840 (DTX1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    1840 (DTX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DTC WWE zf-C3HC4 zf-rbx1 zf-RING_UBOX zf-RING_2 zf-RING_5 zf-ANAPC11 zf-UDP FANCL_C
Motif
Other DBs
NCBI-GeneID: 1840
NCBI-ProteinID: NP_004407
OMIM: 602582
HGNC: 3060
Ensembl: ENSG00000135144
Vega: OTTHUMG00000169610
Pharos: Q86Y01(Tbio)
UniProt: Q86Y01
LinkDB All DBs
Position
12q24.13
AA seq 620 aa AA seqDB search
MSRPGHGGLMPVNGLGFPPQNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSV
VLGQVDAQLVPYIIDLQSMHQFRQDTGTMRPVRRNFYDPSSAPGKGIVWEWENDGGAWTA
YDMDICITIQNAYEKQHPWLDLSSLGFCYLIYFNSMSQMNRQTRRRRRLRRRLDLAYPLT
VGSIPKSQSWPVGASSGQPCSCQQCLLVNSTRAASNAILASQRRKAPPAPPLPPPPPPGG
PPGALAVRPSATFTGAALWAAPAAGPAEPAPPPGAPPRSPGAPGGARTPGQNNLNRPGPQ
RTTSVSARASIPPGVPALPVKNLNGTGPVHPALAGMTGILLCAAGLPVCLTRAPKPILHP
PPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPPDEDCTICMERLVT
ASGYEGVLRHKGVRPELVGRLGRCGHMYHLLCLVAMYSNGNKDGSLQCPTCKAIYGEKTG
TQPPGKMEFHLIPHSLPGFPDTQTIRIVYDIPTGIQGPEHPNPGKKFTARGFPRHCYLPN
NEKGRKVLRLLITAWERRLIFTIGTSNTTGESDTVVWNEIHHKTEFGSNLTGHGYPDASY
LDNVLAELTAQGVSEAAAKA
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtcacggccaggccacggtgggctgatgcctgtgaatggtctgggcttcccaccgcag
aacgtggcccgggtggtggtgtgggagtggctgaatgagcacagccgctggcggccctac
acggccaccgtgtgccaccacattgagaacgtgctgaaggaggacgctcgcggttccgtg
gtcctggggcaggtggacgcccagcttgtgccctacatcatcgacctgcagtccatgcac
cagtttcgccaggacacaggcaccatgcggcccgtgcggcgcaacttctacgacccgtcg
tcggcgccgggcaagggcatcgtgtgggagtgggagaacgacggcggcgcatggacggcc
tacgatatggacatctgcatcaccatccagaacgcctacgagaagcagcacccgtggctc
gacctctcatcgctaggcttctgctacctcatctacttcaacagcatgtcgcagatgaac
cgccagacgcgccggcgccgccgcctgcgccgccgcctggacctcgcctacccgctcacc
gtgggctccatccctaagtcgcagtcgtggcccgtgggcgccagctcgggccagccctgc
tcctgccagcagtgcctgctggtcaacagcacgcgcgccgcctccaacgccatcctggcc
tcgcagcgccgcaaggcgccccccgcgcccccgctgccgccgccgccgccacctggaggg
cctccaggcgcgcttgccgtgcgccccagcgccaccttcacaggcgccgcgctctgggca
gcgcccgccgccggccccgccgagcccgcgccgcctcccggggcgcccccacggagcccg
ggcgcccccggcggagcgcgcaccccggggcagaacaacctcaaccggcccgggccccag
cgcaccaccagcgtgagcgcgcgcgcctccatcccgccgggggtccccgcactcccggtg
aagaacttgaatggtactgggccggtccatccggccctggcagggatgaccgggatactg
ctgtgcgcggccgggctgcccgtgtgcctgacgcgggcccccaagcccatcctgcacccg
ccgcccgtgagcaagagcgacgtgaagcccgtgcctggcgtgcccggggtgtgccgcaag
accaagaagaagcaccttaaaaagagtaagaatcccgaggatgtggttcgaagatacatg
cagaaggtgaaaaacccacctgatgaggactgcaccatctgcatggagcgactggtcaca
gcatcaggctacgagggcgtgcttcggcacaagggcgtgcggcctgagctcgtgggccgc
ctgggccgctgtggccacatgtaccacctgctgtgcctcgtggccatgtactccaatggc
aacaaggatggcagcctgcagtgccccacctgcaaggccatctacggggagaagacgggt
acgcagccgcctgggaagatggagttccacctcatcccccactcgctgcccggcttccct
gatacccagaccatccgcatcgtctatgacatccccacaggcatccagggccctgagcac
cccaaccccgggaagaagttcaccgcaagaggattccctcgccactgctatctacccaac
aacgagaaaggccggaaggtgctgcggctgctcatcacggcctgggagagaagactcatc
ttcactatcggcacgtccaacaccacgggcgagtcggacaccgtggtgtggaacgagatc
caccacaagaccgagtttggatccaacctcacgggccacggctacccggacgctagctac
ctagacaacgtgctggctgagctcacagcccagggcgtatccgaggctgcagccaaggct
tga

KEGG   Homo sapiens (human): 196403Help
Entry
196403            CDS       T01001                                 

Gene name
DTX3, RNF154, deltex3
Definition
(RefSeq) deltex E3 ubiquitin ligase 3
  KO
K06058  deltex [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    196403 (DTX3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    196403 (DTX3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     196403 (DTX3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    196403 (DTX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DTC zf-C3HC4_2 zf-RING_2 zf-C3HC4 zf-C3HC4_3 zf-RING_UBOX zf-rbx1 zf-RING_5 Prok-RING_4 zf-Nse zf-C3HC4_4 zf-RING_10 zf-ANAPC11 DUF1644 zf-RING_11 zf-RING_4
Motif
Other DBs
NCBI-GeneID: 196403
NCBI-ProteinID: NP_001273175
OMIM: 613142
HGNC: 24457
Ensembl: ENSG00000178498
Vega: OTTHUMG00000170189
Pharos: Q8N9I9(Tbio)
UniProt: Q8N9I9 A0A024RB96
LinkDB All DBs
Position
12q13.3
AA seq 347 aa AA seqDB search
MSFVLSRMAACGGTCKNKVTVSKPVWDFLSKETPARLARLREEHRVSILIDGETSDIYVL
QLSPQGPPPAPPNGLYLARKALKGLLKEAEKELKKAQRQGELMGCLALGGGGEHPEMHRA
GPPPLRAAPLLPPGARGLPPPPPPLPPPLPPRLREEAEEQESTCPICLGEIQNAKTLEKC
RHSFCEGCITRALQVKKACPMCGRFYGQLVGNQPQNGRMLVSKDATLLLPSYEKYGTIVI
QYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTLFRKAFDQRLTFTIGTSMTT
GRPNVITWNDIHHKTSCTGGPQLFGYPDPTYLTRVQEELRAKGITDD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcgtcctgtccagaatggcagcctgtggaggcacctgcaagaacaaagtgact
gtgtccaagcccgtgtgggacttcctgagcaaagagaccccagcccggctggcccggctt
cgggaggagcaccgtgtgtccatcctcatagatggcgagacttctgacatctatgttctc
cagctttccccacagggtcctcccccggcccctccaaatgggctctacctagcccggaag
gctctcaaggggctgctaaaagaggcagagaaagagctgaagaaagctcagaggcagggg
gagctgatgggctgcctggctctggggggtggaggggagcaccctgagatgcaccgcgca
ggcccaccccctctccgagcagccccacttctgcccccaggagctcgggggctcccccct
cctcctccccccctgcccccacctcttcctcctcgccttcgggaggaggcagaagagcag
gagagcacctgccccatctgtctgggggagatccagaatgccaagacattggagaagtgc
cggcattcattctgcgagggctgcatcacccgggctctgcaggtgaaaaaggcctgcccc
atgtgcggccgcttctatgggcagctggtgggcaaccagccccagaatgggcggatgctg
gtctctaaggacgccaccctcctactgcccagctatgagaagtacggcaccattgtcatc
cagtacgtcttcccgcccggtgtccagggggctgaacacccaaacccaggagttcggtat
cctggcaccacacgggtggcctacctcccggactgccctgagggcaacaaggtgctgacc
ctgttccgcaaggcgtttgaccagcgtctcaccttcactatcggcacgtccatgaccaca
gggagaccgaatgtcatcacctggaacgacatccaccacaagaccagctgcacaggggga
ccccagctgtttgggtacccagaccccacctacctgacccgggtgcaagaggagctgaga
gcgaagggtatcacagatgactga

KEGG   Homo sapiens (human): 23220Help
Entry
23220             CDS       T01001                                 

Gene name
DTX4, RNF155
Definition
(RefSeq) deltex E3 ubiquitin ligase 4
  KO
K06058  deltex [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    23220 (DTX4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    23220 (DTX4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     23220 (DTX4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    23220 (DTX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DTC WWE zf-C3HC4 zf-RING_UBOX zf-RING_2 zf-rbx1 zf-RING_5 zf-RING_11 zf-ANAPC11 PHD Zn_ribbon_17 zf-UDP Trm112p
Motif
Other DBs
NCBI-GeneID: 23220
NCBI-ProteinID: NP_055992
OMIM: 616110
HGNC: 29151
Ensembl: ENSG00000110042
Vega: OTTHUMG00000167336
Pharos: Q9Y2E6(Tdark)
UniProt: Q9Y2E6
LinkDB All DBs
Position
11q12.1
AA seq 619 aa AA seqDB search
MLLASAVVVWEWLNEHGRWRPYSPAVSHHIEAVVRAGPRAGGSVVLGQVDSRLAPYIIDL
QSMNQFRQDTGTLRPVRRNYYDPSSAPGKGVVWEWENDNGSWTPYDMEVGITIQHAYEKQ
HPWIDLTSIGFSYVIDFNTMGQINRQTQRQRRVRRRLDLIYPMVTGTLPKAQSWPVSPGP
ATSPPMSPCSCPQCVLVMSVKAAVVNGSTGPLQLPVTRKNMPPPGVVKLPPLPGSGAKPL
DSTGTIRGPLKTAPSQVIRRQASSMPTGTTMGSPASPPGPNSKTGRVALATLNRTNLQRL
AIAQSRVLIASGVPTVPVKNLNGSSPVNPALAGITGILMSAAGLPVCLTRPPKLVLHPPP
VSKSEIKSIPGVSNTSRKTTKKQAKKGKTPEEVLKKYLQKVRHPPDEDCTICMERLTAPS
GYKGPQPTVKPDLVGKLSRCGHVYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPP
GKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKG
RKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNV
LAELAAQGISEDSTAQEKD
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggcctcggccgtggtggtctgggaatggctgaacgagcacggccgctggcgt
ccctacagcccagcggtgagccaccacatcgaggcggtggtccgcgccggcccccgcgcg
gggggcagcgtggtgctgggccaggtggacagccgtctcgcgccctacatcatcgacctg
cagtccatgaaccagttccgccaagacacgggaactctccgcccagttcgccgcaactac
tacgacccctcctcggcccctgggaagggcgtggtgtgggagtgggagaacgacaatggc
tcctggacgccctacgacatggaagtgggcatcaccatccagcatgcctatgagaagcag
cacccctggatcgacctcacttccattggctttagctacgtaattgacttcaacaccatg
ggccagatcaaccgtcagacccagcgccaacgccgcgtccgccggcgcctcgacctcatc
taccccatggtcacagggaccttgcctaaggctcagtcctggccagtcagccctgggcca
gccacctcgccccccatgtccccctgctcctgtccccagtgtgtcttggtgatgagtgtt
aaggcagccgtggtcaatggcagcactgggcccctacagctgccagtgacccgcaagaac
atgccgcctcctggagtggtcaagctacccccactgccaggctctggggccaagccactg
gacagcacaggcaccattcgaggcccactgaagaccgccccatcgcaggtgatccggaga
caagcctccagcatgcccactgggacaaccatgggctctcctgccagtcccccaggaccc
aacagcaagaccggaagggtggccctggccaccttgaatcgtaccaacctgcagcgactg
gccattgcccagtcccgggtgctgatcgcctctggggtccccacagtcccagtgaagaac
ctaaatgggtccagtcctgtcaaccctgccttggcaggaatcactgggatcctcatgagt
gcagcggggctgcctgtgtgtctcaccaggccaccaaagctggtcctacacccacccccc
gtcagcaagagtgaaataaaatccatcccaggggtttccaacacaagccgcaagaccacc
aaaaaacaagccaagaaaggtaaaaccccagaggaagtgctaaaaaaatatctacagaaa
gtccggcacccaccagatgaggactgcaccatctgtatggaacgcctcacggccccctca
ggctacaagggcccgcagcctacggtaaaacctgacctggtagggaagctgtccagatgc
ggccacgtctaccacatctactgcttggttgccatgtacaacaatgggaacaaggatgga
agtttgcagtgtccaacctgcaagaccatttatggggtgaagacaggcacccaacctcca
gggaagatggagtaccacctcatcccccactccttgcctggccacccagactgcaaaacc
atccggatcatctacagcatcccccccggcattcagggaccggaacacccgaatcctggg
aagagtttcagcgcccgaggcttcccacgacactgttaccttccggacagcgagaaaggg
agaaaagttctgaagctgctgctcgtggcctgggatcgccgcctcatttttgccattggc
acctccagcaccacaggcgagtcagacaccgtcatctggaatgaggtccaccacaagaca
gagtttggctctaatctcactggccatggctacccagatgccaattacctggataatgtg
ctggctgaactggctgcccagggcatctctgaggacagcactgcccaggagaaggactga

DBGET integrated database retrieval system