KEGG   Homo sapiens (human): 1141
Entry
1141              CDS       T01001                                 

Symbol
CHRNB2, EFNL3, nAChRB2
Name
(RefSeq) cholinergic receptor nicotinic beta 2 subunit
  KO
K04813  nicotinic acetylcholine receptor beta-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa05033  Nicotine addiction
hsa05207  Chemical carcinogenesis - receptor activation
Network
nt06210  ERK signaling
nt06219  JAK-STAT signaling
  Element
N01342  Nicotine to Jak-STAT signaling pathway
N01344  NNK/NNN to RAS-ERK signaling pathway
Disease
H00807  Nocturnal frontal lobe epilepsy
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Altinicline maleate: D02839
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisine: D07770
Dexmecamylamine (DG01378): D10111 D10112
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Ispronicline: D08935
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Pozanicline (DG01288): D09367 D09368
Rivanicline galactarate: D08987
Rocuronium bromide: D00765<JP/US>
Sofinicline (DG01286): D09382 D09383
Tebanicline tosylate: D06016
Tubocurarine (DG00767): D02207 D08655
Varenicline (DG00995): D06282<JP/US> D08669
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1141 (CHRNB2)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1141 (CHRNB2)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    1141 (CHRNB2)
  09165 Substance dependence
   05033 Nicotine addiction
    1141 (CHRNB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1141 (CHRNB2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1141 (CHRNB2)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Other DBs
NCBI-GeneID: 1141
NCBI-ProteinID: NP_000739
OMIM: 118507
HGNC: 1962
Ensembl: ENSG00000160716
Vega: OTTHUMG00000037262
Pharos: P17787(Tclin)
UniProt: P17787 Q5SXY3
LinkDB
Structure
PDB: 
6CNJ 6CNK 5KXI 2LM2 2KSR

Position
1q21.3
AA seq 502 aa
MARRCGPVALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQL
MVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLY
NNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDR
TEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRKPLFYTIN
LIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKY
LMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPRHHCARQR
LRLRRRQREREGAGALFFREAPGADSCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPC
GCGLREAVDGVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQ
PLFQNYTTTTFLHSDHSAPSSK
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggcccggcgctgcggccccgtggcgctgctccttggcttcggcctcctccggctgtgc
tcaggggtgtggggtacggatacagaggagcggctggtggagcatctcctggatccttcc
cgctacaacaagcttatccgcccagccaccaatggctctgagctggtgacagtacagctt
atggtgtcactggcccagctcatcagtgtgcatgagcgggagcagatcatgaccaccaat
gtctggctgacccaggagtgggaagattatcgcctcacctggaagcctgaagagtttgac
aacatgaagaaagttcggctcccttccaaacacatctggctcccagatgtggtcctgtac
aacaatgctgacggcatgtacgaggtgtccttctattccaatgccgtggtctcctatgat
ggcagcatcttctggctgccgcctgccatctacaagagcgcatgcaagattgaagtaaag
cacttcccatttgaccagcagaactgcaccatgaagttccgttcgtggacctacgaccgc
acagagatcgacttggtgctgaagagtgaggtggccagcctggacgacttcacacctagt
ggtgagtgggacatcgtggcgctgccgggccggcgcaacgagaaccccgacgactctacg
tacgtggacatcacgtatgacttcatcattcgccgcaagccgctcttctacaccatcaac
ctcatcatcccctgtgtgctcatcacctcgctagccatccttgtcttctacctgccatcc
gactgtggcgagaagatgacgttgtgcatctcagtgctgctggcgctcacggtcttcctg
ctgctcatctccaagatcgtgcctcccacctccctcgacgtgccgctcgtcggcaagtac
ctcatgttcaccatggtgcttgtcaccttctccatcgtcaccagcgtgtgcgtgctcaac
gtgcaccaccgctcgcccaccacgcacaccatggcgccctgggtgaaggtcgtcttcctg
gagaagctgcccgcgctgctcttcatgcagcagccacgccatcattgcgcccgtcagcgc
ctgcgcctgcggcgacgccagcgtgagcgcgagggcgctggagccctcttcttccgcgaa
gccccaggggccgactcctgcacgtgcttcgtcaaccgcgcgtcggtgcaggggttggcc
ggggccttcggggctgagcctgcaccagtggcgggccccgggcgctcaggggagccgtgt
ggctgtggcctccgggaggcggtggacggcgtgcgcttcatcgcagaccacatgcggagc
gaggacgatgaccagagcgtgagtgaggactggaagtacgtcgccatggtgatcgaccgc
ctcttcctctggatctttgtctttgtctgtgtctttggcaccatcggcatgttcctgcag
cctctcttccagaactacaccaccaccaccttcctccactcagaccactcagcccccagc
tccaagtga

DBGET integrated database retrieval system