KEGG   Homo sapiens (human): 114112Help
Entry
114112            CDS       T01001                                 

Gene name
TXNRD3, TGR, TR2, TR2IT1, TRXR3, TXNRD3IT1, TXNRD3NB, TXNRD3NT1
Definition
(RefSeq) thioredoxin reductase 3
  KO
K22182  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00450  Selenocompound metabolism
hsa05200  Pathways in cancer
hsa05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    114112 (TXNRD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114112 (TXNRD3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    114112 (TXNRD3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     114112 (TXNRD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Glutaredoxin Pyr_redox_3 FAD_binding_2 AlaDh_PNT_C DAO Thi4 HI0933_like FAD_oxidored GIDA NAD_binding_7 NAD_binding_8 Peptidase_C70 FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 114112
NCBI-ProteinID: NP_443115
OMIM: 606235
HGNC: 20667
Ensembl: ENSG00000197763
Vega: OTTHUMG00000162733
Pharos: Q86VQ6(Tdark)
UniProt: Q86VQ6
LinkDB All DBs
Structure
PDB: 

Position
3q21.3
AA seq 643 aa AA seqDB search
MERSPPQSPGPGKAGDAPNRRSGHVRGARVLSPPGRRARLSSPGPSRSSEAREELRRHLV
GLIERSRVVIFSKSYCPHSTRVKELFSSLGVECNVLELDQVDDGARVQEVLSEITNQKTV
PNIFVNKVHVGGCDQTFQAYQSGLLQKLLQEDLAYDYDLIIIGGGSGGLSCAKEAAILGK
KVMVLDFVVPSPQGTSWGLGGTCVNVGCIPKKLMHQAALLGQALCDSRKFGWEYNQQVRH
NWETMTKAIQNHISSLNWGYRLSLREKAVAYVNSYGEFVEHHKIKATNKKGQETYYTAAQ
FVIATGERPRYLGIQGDKEYCITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGFGLDV
TVMVRSILLRGFDQEMAEKVGSYMEQHGVKFLRKFIPVMVQQLEKGSPGKLKVLAKSTEG
TETIEGVYNTVLLAIGRDSCTRKIGLEKIGVKINEKSGKIPVNDVEQTNVPYVYAVGDIL
EDKPELTPVAIQSGKLLAQRLFGASLEKCDYINVPTTVFTPLEYGCCGLSEEKAIEVYKK
ENLEIYHTLFWPLEWTVAGRENNTCYAKIICNKFDHDRVIGFHILGPNAGEVTQGFAAAM
KCGLTKQLLDDTIGIHPTCGEVFTTLEITKSSGLDITQKGCUG
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
ctggagcggtcgccgccgcagtcgcccgggccgggaaaggcgggcgatgcccccaaccgc
cgctcgggccatgtccgaggggcgcgcgtgttgtcgccgccggggcgccgtgcccgcctg
tcgtcccccgggcccagccgctcgtccgaggcccgcgaggagctgcgccgccacctcgtg
ggcctcatcgagcgcagccgggtggtgatcttcagcaagagctactgtccccatagtact
cgggtgaaagaactcttttcttctttgggagtcgaatgtaatgtcttggaacttgatcaa
gttgatgatggggccagggttcaagaagtgctgtcagaaatcactaatcagaaaactgtg
cccaatattttcgtgaataaagtgcatgtaggtggatgtgaccaaactttccaggcatat
cagagtggtttgttacagaagctccttcaggaagatttggcatatgattatgatctcatc
atcatcggtggtggttctggaggcctttcatgtgcgaaggaagctgccattttgggaaag
aaagttatggtgctagactttgttgtcccgtcacctcagggcacatcctggggtcttggt
ggcacttgtgtaaatgtaggttgtattcctaagaaattgatgcatcaggctgcccttttg
gggcaggcattatgtgactcaaggaaatttggctgggaatataatcaacaagtgaggcac
aactgggagacaatgacaaaagcgattcagaaccacatcagctctctaaactggggctac
aggttgtctctgagggaaaaggctgtggcctatgtcaattcctatggagaatttgttgaa
catcataaaataaaggcaaccaataaaaaaggacaggagacttattatactgctgcacag
tttgtcatagcaacgggtgaaaggccacggtatttaggaatccaaggagataaagaatac
tgtattactagtgatgaccttttttctctgccttattgccctggcaaaacattagtggtg
ggtgcctcttatgttgccctggagtgtgcagggtttctggctggctttggcctagatgtc
acagttatggtacgctcaatccttctccgtggcttcgaccaagaaatggcagaaaaagtg
ggttcctacatggagcagcatggtgtgaagttcctacggaaattcatacctgtgatggtt
caacagttggagaaaggttcacctggaaagctgaaagtgttggctaaatccactgaagga
acagaaacaattgaaggagtctataacacagttttgttagctattggtcgtgactcctgt
acaaggaaaataggcttggagaagattggtgtcaaaattaatgagaagagtggaaaaata
cctgtaaatgatgtggaacagaccaatgtgccatatgtctatgctgttggtgatattttg
gaggataagccagagctcactcctgtcgccatacagtcaggcaagctgctagctcagaga
ctttttggggcctctttagaaaagtgtgattatattaatgttccgactacagtgtttact
cctctggagtatggttgctgtggattatctgaagagaaagctattgaagtatataaaaaa
gagaatctagaaatatatcatactttgttctggcctcttgaatggacagtagctggcaga
gagaacaacacttgttatgcaaagataatctgcaataaattcgaccatgatcgggtgata
ggatttcatattcttggaccaaacgccggtgaggttacccaaggatttgcagctgcaatg
aaatgtgggctcacaaaacagctacttgatgacaccattggaattcaccccacatgtggg
gaggtgttcacgactttggaaatcacaaagtcgtcaggactagacatcactcagaaaggc
tgctgaggctag

DBGET integrated database retrieval system