KEGG   Homo sapiens (human): 114131
Entry
114131            CDS       T01001                                 

Gene name
UCN3, SCP, SPC, UCNIII
Definition
(RefSeq) urocortin 3
  KO
K05257  urocortin 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114131 (UCN3)
SSDB
Motif
Pfam: CRF
Other DBs
NCBI-GeneID: 114131
NCBI-ProteinID: NP_444277
OMIM: 605901
HGNC: 17781
Ensembl: ENSG00000178473
Vega: OTTHUMG00000017594
Pharos: Q969E3(Tbio)
CPD: C16082
UniProt: Q969E3
LinkDB
Position
10p15.1
AA seq 161 aa
MLMPVHFLLLLLLLLGGPRTGLPHKFYKAKPIFSCLNTALSEAEKGQWEDASLLSKRSFH
YLRSRDASSGEEEEGKEKKTFPISGARGGARGTRYRYVSQAQPRGKPRQDTAKSPHRTKF
TLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQIGRKK
NT seq 486 nt   +upstreamnt  +downstreamnt
atgctgatgccggtccacttcctgctgctcctgctgctgctcctggggggccccaggaca
ggcctcccccacaagttctacaaagccaagcccatcttcagctgcctcaacaccgccctg
tctgaggctgagaagggccagtgggaggatgcatccctgctgagcaagaggagcttccac
tacctgcgcagcagagacgcctcttcgggagaggaggaggagggcaaagagaaaaagact
ttccccatctctggggccaggggtggagccagaggcacccggtacagatacgtgtcccaa
gcacagcccaggggaaagccacgccaggacacggccaagagtccccaccgcaccaagttc
accctgtccctcgacgtccccaccaacatcatgaacctcctcttcaacatcgccaaggcc
aagaacctgcgtgcccaggcggccgccaatgcccacctgatggcgcaaattgggaggaag
aagtag

KEGG   Homo sapiens (human): 1392
Entry
1392              CDS       T01001                                 

Gene name
CRH, CRF, CRH1
Definition
(RefSeq) corticotropin releasing hormone
  KO
K05256  corticotropin-releasing hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04730  Long-term depression
hsa04934  Cushing syndrome
hsa05034  Alcoholism
Network
nt06310  CRH-ACTH-cortisol signaling
nt06360  Cushing syndrome
  Element
N00324  CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1392 (CRH)
 09150 Organismal Systems
  09156 Nervous system
   04730 Long-term depression
    1392 (CRH)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    1392 (CRH)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    1392 (CRH)
SSDB
Motif
Pfam: CRF
Other DBs
NCBI-GeneID: 1392
NCBI-ProteinID: NP_000747
OMIM: 122560
HGNC: 2355
Ensembl: ENSG00000147571
Vega: OTTHUMG00000164474
Pharos: P06850(Tbio)
CPD: C16079
UniProt: P06850 A0A0S2Z478
LinkDB
Structure
PDB: 
1GO9 1GOE

Position
8q13.1
AA seq 196 aa
MRLPLLVSAGVLLVALLPCPPCRALLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQ
ARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLL
LPRRSLDSPAALAERGARNALGGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQL
AQQAHSNRKLMEIIGK
NT seq 591 nt   +upstreamnt  +downstreamnt
atgcggctgccgctgcttgtgtccgcgggagtcctgctggtggctctcctgccctgcccg
ccatgcagggcgctcctgagccgcgggccggtcccgggagctcggcaggcgccgcagcac
cctcagcccttggatttcttccagccgccgccgcagtccgagcagccccagcagccgcag
gctcggccggtcctgctccgcatgggagaggagtacttcctccgcctggggaacctcaac
aagagcccggccgctcccctttcgcccgcctcctcgctcctcgccggaggcagcggcagc
cgcccttcgccggaacaggcgaccgccaactttttccgcgtgttgctgcagcagctgctg
ctgcctcggcgctcgctcgacagccccgcggctctcgcggagcgcggcgctaggaatgcc
ctcggcggccaccaggaggcaccggagagagaaaggcggtccgaggagcctcccatctcc
ctggatctcaccttccacctcctccgggaagtcttggaaatggccagggccgagcagtta
gcacagcaagctcacagcaacaggaaactcatggagattattgggaaataa

KEGG   Homo sapiens (human): 7349
Entry
7349              CDS       T01001                                 

Gene name
UCN, UI, UROC
Definition
(RefSeq) urocortin
  KO
K23142  urcortin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    7349 (UCN)
SSDB
Motif
Pfam: CRF
Other DBs
NCBI-GeneID: 7349
NCBI-ProteinID: NP_003344
OMIM: 600945
HGNC: 12516
Ensembl: ENSG00000163794
Vega: OTTHUMG00000097068
Pharos: P55089(Tbio)
CPD: C16080
UniProt: P55089
LinkDB
Position
2p23.3
AA seq 124 aa
MRQAGRAALLAALLLLVQLCPGSSQRSPEAAGVQDPSLRWSPGARNQGGGARALLLLLAE
RFPRRAGPGRLGLGTAGERPRRDNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFD
SVGK
NT seq 375 nt   +upstreamnt  +downstreamnt
atgaggcaggcgggacgcgcagcgctgctggccgcgctgctgctcctggtacagctgtgc
cctgggagcagccagaggagccccgaggcggccggggtccaggacccgagtctgcgctgg
agccccggggcacggaaccagggtggcggggcccgcgcgctcctcttgctgctggcggag
cgcttcccgcgccgcgcggggcccggccgattgggactcgggacggcaggcgagcggccg
cggcgggacaacccttctctgtccattgacctcacctttcacctgctgcggaccctgctg
gagctggcgcggacgcagagccagcgggagcgcgccgagcagaaccgcatcatattcgac
tcggtgggcaagtga

KEGG   Homo sapiens (human): 90226
Entry
90226             CDS       T01001                                 

Gene name
UCN2, SRP, UCN-II, UCNI, UR, URP
Definition
(RefSeq) urocortin 2
  KO
K05257  urocortin 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    90226 (UCN2)
SSDB
Motif
Pfam: CRF
Other DBs
NCBI-GeneID: 90226
NCBI-ProteinID: NP_149976
OMIM: 605902
HGNC: 18414
Ensembl: ENSG00000145040
Vega: OTTHUMG00000133533
Pharos: Q96RP3(Tbio)
CPD: C16081
UniProt: Q96RP3
LinkDB
Position
3p21.31
AA seq 112 aa
MTRCALLLLMVLMLGRVLVVPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQS
HCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC
NT seq 339 nt   +upstreamnt  +downstreamnt
atgaccaggtgtgctctgctgttgctgatggtcctgatgttgggcagagtcctggttgtc
ccagtgacccctatcccaaccttccagctccgccctcagaattctccccagaccactccc
cgacctgcggcctcagagagcccctcagctgctcccacatggccgtgggctgcccagagc
cactgcagccccacccgccaccctggctcgcgcattgtcctatcgctggatgtccccatc
ggcctcttgcagatcttactggagcaagcccgggccagggctgccagggagcaggccacc
accaacgcccgcatcctggcccgtgtcggccactgctga

DBGET integrated database retrieval system