KEGG   Homo sapiens (human): 1145Help
Entry
1145              CDS       T01001                                 

Gene name
CHRNE, ACHRE, CMS1D, CMS1E, CMS2A, CMS4A, CMS4B, CMS4C, FCCMS, SCCMS
Definition
(RefSeq) cholinergic receptor nicotinic epsilon subunit
  KO
K04817  nicotinic acetylcholine receptor epsilon
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00770  Congenital myasthenic syndrome
Drug target
Acetylcholine (DG01133): D00999
Cytisine: D07770
Gantacurium chloride: D04303
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611
Metocurine iodide: D00761
Nicotine (DG00994): D03365 D05156 D05157
Rapacuronium bromide: D05703
Suxamethonium (DG00768): D00766 D02275
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1145 (CHRNE)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1145 (CHRNE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 1145
NCBI-ProteinID: NP_000071
OMIM: 100725
HGNC: 1966
Ensembl: ENSG00000108556
Vega: OTTHUMG00000090778
Pharos: Q04844(Tclin)
UniProt: Q04844
LinkDB All DBs
Position
17p13.2
AA seq 493 aa AA seqDB search
MARAPLGVLLLLGLLGRGVGKNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNL
ISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQF
GVAYDANVLVYEGGSVTWLPPAIYRSVCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFTF
AVDNDGKTINKIDIDTEAYTENGEWAIDFCPGVIRRHHGGATDGPGETDVIYSLIIRRKP
LFYVINIIVPCVLISGLVLLAYFLPAQAGGQKCTVSINVLLAQTVFLFLIAQKIPETSLS
VPLLGRFLIFVMVVATLIVMNCVIVLNVSQRTPTTHAMSPRLRHVLLELLPRLLGSPPPP
EAPRAASPPRRASSVGLLLRAEELILKKPRSELVFEGQRHRQGTWTAAFCQSLGAAAPEV
RCCVDAVNFVAESTRDQEATGEEVSDWVRMGNALDNICFWAALVLFSVGSSLIFLGAYFN
RVPDLPYAPCIQP
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggcaagggctccgcttggggtcctgctcctcttggggcttctcggcaggggtgtgggg
aagaacgaggaactgcgtctttatcaccatctcttcaacaactatgacccaggaagccgg
ccagtgcgggagcctgaggatactgtcaccatcagcctcaaggtcaccctgacgaatctc
atctcactgaatgaaaaagaggagactctcaccactagcgtctggattggaatcgattgg
caggattaccgactcaactacagcaaggacgactttgggggtatagaaaccctgcgagtc
ccttcagaactcgtgtggctgccagagattgtgctggaaaacaatattgatggccagttc
ggagtggcctacgacgccaacgtgctcgtctacgagggcggctccgtgacgtggctgcct
ccggccatctaccgcagcgtctgcgcagtggaggtcacctacttccccttcgattggcag
aactgttcgcttattttccgctctcagacgtacaatgccgaagaggtggagttcactttt
gccgtagacaacgacggcaagaccatcaacaagatcgacatcgacacagaggcctatact
gagaacggcgagtgggccatcgacttctgcccgggggtgatccgccgccaccacggtggc
gccaccgacggcccaggggagactgacgtcatctactcgctcatcatccgccggaagccg
ctcttctacgtcattaacatcatcgtgccctgtgtgctcatctcgggcctggtgctgctc
gcctacttcctgccggcgcaggccggcggccagaaatgcacggtctccatcaacgtcctg
ctcgcccagaccgtcttcttgttcctcattgcccagaaaatcccagagacttctctgagc
gtgccgctcctgggcaggttccttattttcgtcatggtggtcgccacgctcattgtcatg
aattgcgtcatcgtgctcaacgtgtcccagcggacgcccaccacccacgccatgtccccg
cggctgcgccacgttctcctggagctgctgccgcgcctcctgggctccccgccgccgccc
gaggccccccgggccgcctcgcccccaaggcgggcgtcgtcggtgggcttattgctccgc
gcggaggagctgatactgaaaaagccacggagcgagctcgtgtttgaggggcagaggcac
cggcaggggacctggacggctgccttctgccagagcctgggcgccgccgcccccgaggtc
cgctgctgtgtggatgccgtgaacttcgtggccgagagcacgagagatcaggaggccacc
ggcgaggaagtgtccgactgggtgcgcatggggaatgcccttgacaacatctgcttctgg
gccgctctggtgctcttcagcgtgggctccagcctcatcttcctcggggcctacttcaac
cgagtgcctgatctcccctacgcgccgtgtatccagccttag

DBGET integrated database retrieval system