KEGG   Homo sapiens (human): 114548Help
Entry
114548            CDS       T01001                                 

Gene name
NLRP3, AGTAVPRL, AII, AVP, C1orf7, CIAS1, CLR1.1, DFNA34, FCAS, FCAS1, FCU, KEFH, MWS, NALP3, PYPAF1
Definition
(RefSeq) NLR family pyrin domain containing 3
  KO
K12800  NACHT, LRR and PYD domains-containing protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05164  Influenza A
Network
nt06170  Influenza A virus (IAV)
  Element
N00742  NLRP3 Inflammasome signaling pathway
N00743  IAV NS1 to NLRP3 inflammasome signaling pathway
Disease
H00282  Cryopyrin associated periodic syndrome
H01359  Anaphylaxis
H02159  Familial cold autoinflammatory syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    114548 (NLRP3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    114548 (NLRP3)
   04625 C-type lectin receptor signaling pathway
    114548 (NLRP3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    114548 (NLRP3)
   05135 Yersinia infection
    114548 (NLRP3)
   05133 Pertussis
    114548 (NLRP3)
  09172 Infectious disease: viral
   05164 Influenza A
    114548 (NLRP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    114548 (NLRP3)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    114548 (NLRP3)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    114548 (NLRP3)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   114548 (NLRP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT NLRC4_HD2 PYRIN LRR_6 NOD2_WH FISNA LRR_4 LRR_8
Motif
Other DBs
NCBI-GeneID: 114548
NCBI-ProteinID: NP_001073289
OMIM: 606416
HGNC: 16400
Ensembl: ENSG00000162711
Vega: OTTHUMG00000040647
Pharos: Q96P20(Tbio)
UniProt: Q96P20
LinkDB All DBs
Structure
PDB: 

Position
1q44
AA seq 1036 aa AA seqDB search
MKMASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMID
FNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPTVICQEDSIEEEWMGL
LEYLSRISICKMKKDYRKKYRKYVRSRFQCIEDRNARLGESVSLNKRYTRLRLIKEHRSQ
QEREQELLAIGKTKTCESPVSPIKMELLFDPDDEHSEPVHTVVFQGAAGIGKTILARKMM
LDWASGTLYQDRFDYLFYIHCREVSLVTQRSLGDLIMSCCPDPNPPIHKIVRKPSRILFL
MDGFDELQGAFDEHIGPLCTDWQKAERGDILLSSLIRKKLLPEASLLITTRPVALEKLQH
LLDHPRHVEILGFSEAKRKEYFFKYFSDEAQARAAFSLIQENEVLFTMCFIPLVCWIVCT
GLKQQMESGKSLAQTSKTTTAVYVFFLSSLLQPRGGSQEHGLCAHLWGLCSLAADGIWNQ
KILFEESDLRNHGLQKADVSAFLRMNLFQKEVDCEKFYSFIHMTFQEFFAAMYYLLEEEK
EGRTNVPGSRLKLPSRDVTVLLENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKKLSCKI
SQQIRLELLKWIEVKAKAKKLQIQPSQLELFYCLYEMQEEDFVQRAMDYFPKIEINLSTR
MDHMVSSFCIENCHRVESLSLGFLHNMPKEEEEEEKEGRHLDMVQCVLPSSSHAACSHGL
VNSHLTSSFCRGLFSVLSTSQSLTELDLSDNSLGDPGMRVLCETLQHPGCNIRRLWLGRC
GLSHECCFDISLVLSSNQKLVELDLSDNALGDFGIRLLCVGLKHLLCNLKKLWLVSCCLT
SACCQDLASVLSTSHSLTRLYVGENALGDSGVAILCEKAKNPQCNLQKLGLVNSGLTSVC
CSALSSVLSTNQNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVLELDNCNLTSHCCWD
LSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALET
LQEEKPELTVVFEPSW
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atgaagatggcaagcacccgctgcaagctggccaggtacctggaggacctggaggatgtg
gacttgaagaaatttaagatgcacttagaggactatcctccccagaagggctgcatcccc
ctcccgaggggtcagacagagaaggcagaccatgtggatctagccacgctaatgatcgac
ttcaatggggaggagaaggcgtgggccatggccgtgtggatcttcgctgcgatcaacagg
agagacctttatgagaaagcaaaaagagatgagccgaagtggggttcagataatgcacgt
gtttcgaatcccactgtgatatgccaggaagacagcattgaagaggagtggatgggttta
ctggagtacctttcgagaatctctatttgtaaaatgaagaaagattaccgtaagaagtac
agaaagtacgtgagaagcagattccagtgcattgaagacaggaatgcccgtctgggtgag
agtgtgagcctcaacaaacgctacacacgactgcgtctcatcaaggagcaccggagccag
caggagagggagcaggagcttctggccatcggcaagaccaagacgtgtgagagccccgtg
agtcccattaagatggagttgctgtttgaccccgatgatgagcattctgagcctgtgcac
accgtggtgttccagggggcggcagggattgggaaaacaatcctggccaggaagatgatg
ttggactgggcgtcggggacactctaccaagacaggtttgactatctgttctatatccac
tgtcgggaggtgagccttgtgacacagaggagcctgggggacctgatcatgagctgctgc
cccgacccaaacccacccatccacaagatcgtgagaaaaccctccagaatcctcttcctc
atggacggcttcgatgagctgcaaggtgcctttgacgagcacataggaccgctctgcact
gactggcagaaggccgagcggggagacattctcctgagcagcctcatcagaaagaagctg
cttcccgaggcctctctgctcatcaccacgagacctgtggccctggagaaactgcagcac
ttgctggaccatcctcggcatgtggagatcctgggtttctccgaggccaaaaggaaagag
tacttcttcaagtacttctctgatgaggcccaagccagggcagccttcagtctgattcag
gagaacgaggtcctcttcaccatgtgcttcatccccctggtctgctggatcgtgtgcact
ggactgaaacagcagatggagagtggcaagagccttgcccagacatccaagaccaccacc
gcggtgtacgtcttcttcctttccagtttgctgcagccccggggagggagccaggagcac
ggcctctgcgcccacctctgggggctctgctctttggctgcagatggaatctggaaccag
aaaatcctgtttgaggagtccgacctcaggaatcatggactgcagaaggcggatgtgtct
gctttcctgaggatgaacctgttccaaaaggaagtggactgcgagaagttctacagcttc
atccacatgactttccaggagttctttgccgccatgtactacctgctggaagaggaaaag
gaaggaaggacgaacgttccagggagtcgtttgaagcttcccagccgagacgtgacagtc
cttctggaaaactatggcaaattcgaaaaggggtatttgatttttgttgtacgtttcctc
tttggcctggtaaaccaggagaggacctcctacttggagaagaaattaagttgcaagatc
tctcagcaaatcaggctggagctgctgaaatggattgaagtgaaagccaaagctaaaaag
ctgcagatccagcccagccagctggaattgttctactgtttgtacgagatgcaggaggag
gacttcgtgcaaagggccatggactatttccccaagattgagatcaatctctccaccaga
atggaccacatggtttcttccttttgcattgagaactgtcatcgggtggagtcactgtcc
ctggggtttctccataacatgcccaaggaggaagaggaggaggaaaaggaaggccgacac
cttgatatggtgcagtgtgtcctcccaagctcctctcatgctgcctgttctcatggattg
gtgaacagccacctcacttccagtttttgccggggcctcttttcagttctgagcaccagc
cagagtctaactgaattggacctcagtgacaattctctgggggacccagggatgagagtg
ttgtgtgaaacgctccagcatcctggctgtaacattcggagattgtggttggggcgctgt
ggcctctcgcatgagtgctgcttcgacatctccttggtcctcagcagcaaccagaagctg
gtggagctggacctgagtgacaacgccctcggtgacttcggaatcagacttctgtgtgtg
ggactgaagcacctgttgtgcaatctgaagaagctctggttggtcagctgctgcctcaca
tcagcatgttgtcaggatcttgcatcagtattgagcaccagccattccctgaccagactc
tatgtgggggagaatgccttgggagactcaggagtcgcaattttatgtgaaaaagccaag
aatccacagtgtaacctgcagaaactggggttggtgaattctggccttacgtcagtctgt
tgttcagctttgtcctcggtactcagcactaatcagaatctcacgcacctttacctgcga
ggcaacactctcggagacaaggggatcaaactactctgtgagggactcttgcaccccgac
tgcaagcttcaggtgttggaattagacaactgcaacctcacgtcacactgctgctgggat
ctttccacacttctgacctccagccagagcctgcgaaagctgagcctgggcaacaatgac
ctgggcgacctgggggtcatgatgttctgtgaagtgctgaaacagcagagctgcctcctg
cagaacctggggttgtctgaaatgtatttcaattatgagacaaaaagtgcgttagaaaca
cttcaagaagaaaagcctgagctgaccgtcgtctttgagccttcttggtag

DBGET integrated database retrieval system