KEGG   Homo sapiens (human): 114548
Entry
114548            CDS       T01001                                 

Gene name
NLRP3, AGTAVPRL, AII, AVP, C1orf7, CIAS1, CLR1.1, DFNA34, FCAS, FCAS1, FCU, KEFH, MWS, NALP3, PYPAF1
Definition
(RefSeq) NLR family pyrin domain containing 3
  KO
K12800  NACHT, LRR and PYD domains-containing protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05164  Influenza A
hsa05171  Coronavirus disease - COVID-19
Network
nt06139  NLR signaling (viruses and bacteria)
nt06170  Influenza A virus (IAV)
  Element
N00742  NLRP3 Inflammasome signaling pathway
N00743  IAV NS1 to NLRP3 inflammasome signaling pathway
N00864  Yersinia YopK to NLRP3 Inflammasome signaling pathway
N00933  Escherichia NleA to NLRP3 inflammasome signaling pathway
N00934  Non-canonical inflammasome signaling pathway
N00948  Shigella IpaH7.8 to NLRP3 Inflammasome signaling pathway
Disease
H00282  Cryopyrin associated periodic syndrome
H01359  Anaphylaxis
H02159  Familial cold autoinflammatory syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    114548 (NLRP3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    114548 (NLRP3)
   04625 C-type lectin receptor signaling pathway
    114548 (NLRP3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    114548 (NLRP3)
   05132 Salmonella infection
    114548 (NLRP3)
   05131 Shigellosis
    114548 (NLRP3)
   05135 Yersinia infection
    114548 (NLRP3)
   05133 Pertussis
    114548 (NLRP3)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    114548 (NLRP3)
   05164 Influenza A
    114548 (NLRP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    114548 (NLRP3)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    114548 (NLRP3)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    114548 (NLRP3)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   114548 (NLRP3)
SSDB
Motif
Pfam: NACHT NLRC4_HD2 PYRIN NOD2_WH LRR_6 FISNA LRR_4 LRR_8
Other DBs
NCBI-GeneID: 114548
NCBI-ProteinID: NP_004886
OMIM: 606416
HGNC: 16400
Ensembl: ENSG00000162711
Vega: OTTHUMG00000040647
Pharos: Q96P20(Tbio)
UniProt: Q96P20
LinkDB
Structure
PDB: 
3QF2 6NPY 2NAQ

Position
1q44
AA seq 1036 aa
MKMASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMID
FNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPTVICQEDSIEEEWMGL
LEYLSRISICKMKKDYRKKYRKYVRSRFQCIEDRNARLGESVSLNKRYTRLRLIKEHRSQ
QEREQELLAIGKTKTCESPVSPIKMELLFDPDDEHSEPVHTVVFQGAAGIGKTILARKMM
LDWASGTLYQDRFDYLFYIHCREVSLVTQRSLGDLIMSCCPDPNPPIHKIVRKPSRILFL
MDGFDELQGAFDEHIGPLCTDWQKAERGDILLSSLIRKKLLPEASLLITTRPVALEKLQH
LLDHPRHVEILGFSEAKRKEYFFKYFSDEAQARAAFSLIQENEVLFTMCFIPLVCWIVCT
GLKQQMESGKSLAQTSKTTTAVYVFFLSSLLQPRGGSQEHGLCAHLWGLCSLAADGIWNQ
KILFEESDLRNHGLQKADVSAFLRMNLFQKEVDCEKFYSFIHMTFQEFFAAMYYLLEEEK
EGRTNVPGSRLKLPSRDVTVLLENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKKLSCKI
SQQIRLELLKWIEVKAKAKKLQIQPSQLELFYCLYEMQEEDFVQRAMDYFPKIEINLSTR
MDHMVSSFCIENCHRVESLSLGFLHNMPKEEEEEEKEGRHLDMVQCVLPSSSHAACSHGL
VNSHLTSSFCRGLFSVLSTSQSLTELDLSDNSLGDPGMRVLCETLQHPGCNIRRLWLGRC
GLSHECCFDISLVLSSNQKLVELDLSDNALGDFGIRLLCVGLKHLLCNLKKLWLVSCCLT
SACCQDLASVLSTSHSLTRLYVGENALGDSGVAILCEKAKNPQCNLQKLGLVNSGLTSVC
CSALSSVLSTNQNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVLELDNCNLTSHCCWD
LSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALET
LQEEKPELTVVFEPSW
NT seq 3111 nt   +upstreamnt  +downstreamnt
atgaagatggcaagcacccgctgcaagctggccaggtacctggaggacctggaggatgtg
gacttgaagaaatttaagatgcacttagaggactatcctccccagaagggctgcatcccc
ctcccgaggggtcagacagagaaggcagaccatgtggatctagccacgctaatgatcgac
ttcaatggggaggagaaggcgtgggccatggccgtgtggatcttcgctgcgatcaacagg
agagacctttatgagaaagcaaaaagagatgagccgaagtggggttcagataatgcacgt
gtttcgaatcccactgtgatatgccaggaagacagcattgaagaggagtggatgggttta
ctggagtacctttcgagaatctctatttgtaaaatgaagaaagattaccgtaagaagtac
agaaagtacgtgagaagcagattccagtgcattgaagacaggaatgcccgtctgggtgag
agtgtgagcctcaacaaacgctacacacgactgcgtctcatcaaggagcaccggagccag
caggagagggagcaggagcttctggccatcggcaagaccaagacgtgtgagagccccgtg
agtcccattaagatggagttgctgtttgaccccgatgatgagcattctgagcctgtgcac
accgtggtgttccagggggcggcagggattgggaaaacaatcctggccaggaagatgatg
ttggactgggcgtcggggacactctaccaagacaggtttgactatctgttctatatccac
tgtcgagaggtgagccttgtgacacagaggagcctgggggacctgatcatgagctgctgc
cccgacccaaacccacccatccacaagatcgtgagaaaaccctccagaatcctcttcctc
atggacggcttcgatgagctgcaaggtgcctttgacgagcacataggaccgctctgcact
gactggcagaaggccgagcggggagacattctcctgagcagcctcatcagaaagaagctg
cttcccgaggcctctctgctcatcaccacgagacctgtggccctggagaaactgcagcac
ttgctggaccatcctcggcatgtggagatcctgggtttctccgaggccaaaaggaaagag
tacttcttcaagtacttctctgatgaggcccaagccagggcagccttcagtctgattcag
gagaacgaggtcctcttcaccatgtgcttcatccccctggtctgctggatcgtgtgcact
ggactgaaacagcagatggagagtggcaagagccttgcccagacatccaagaccaccacc
gcggtgtacgtcttcttcctttccagtttgctgcagccccggggagggagccaggagcac
ggcctctgcgcccacctctgggggctctgctctttggctgcagatggaatctggaaccag
aaaatcctgtttgaggagtccgacctcaggaatcatggactgcagaaggcggatgtgtct
gctttcctgaggatgaacctgttccaaaaggaagtggactgcgagaagttctacagcttc
atccacatgactttccaggagttctttgccgccatgtactacctgctggaagaggaaaag
gaaggaaggacgaacgttccagggagtcgtttgaagcttcccagccgagacgtgacagtc
cttctggaaaactatggcaaattcgaaaaggggtatttgatttttgttgtacgtttcctc
tttggcctggtaaaccaggagaggacctcctacttggagaagaaattaagttgcaagatc
tctcagcaaatcaggctggagctgctgaaatggattgaagtgaaagccaaagctaaaaag
ctgcagatccagcccagccagctggaattgttctactgtttgtacgagatgcaggaggag
gacttcgtgcaaagggccatggactatttccccaagattgagatcaatctctccaccaga
atggaccacatggtttcttccttttgcattgagaactgtcatcgggtggagtcactgtcc
ctggggtttctccataacatgcccaaggaggaagaggaggaggaaaaggaaggccgacac
cttgatatggtgcagtgtgtcctcccaagctcctctcatgctgcctgttctcatggattg
gtgaacagccacctcacttccagtttttgccggggcctcttttcagttctgagcaccagc
cagagtctaactgaattggacctcagtgacaattctctgggggacccagggatgagagtg
ttgtgtgaaacgctccagcatcctggctgtaacattcggagattgtggttggggcgctgt
ggcctctcgcatgagtgctgcttcgacatctccttggtcctcagcagcaaccagaagctg
gtggagctggacctgagtgacaacgccctcggtgacttcggaatcagacttctgtgtgtg
ggactgaagcacctgttgtgcaatctgaagaagctctggttggtcagctgctgcctcaca
tcagcatgttgtcaggatcttgcatcagtattgagcaccagccattccctgaccagactc
tatgtgggggagaatgccttgggagactcaggagtcgcaattttatgtgaaaaagccaag
aatccacagtgtaacctgcagaaactggggttggtgaattctggccttacgtcagtctgt
tgttcagctttgtcctcggtactcagcactaatcagaatctcacgcacctttacctgcga
ggcaacactctcggagacaaggggatcaaactactctgtgagggactcttgcaccccgac
tgcaagcttcaggtgttggaattagacaactgcaacctcacgtcacactgctgctgggat
ctttccacacttctgacctccagccagagcctgcgaaagctgagcctgggcaacaatgac
ctgggcgacctgggggtcatgatgttctgtgaagtgctgaaacagcagagctgcctcctg
cagaacctggggttgtctgaaatgtatttcaattatgagacaaaaagtgcgttagaaaca
cttcaagaagaaaagcctgagctgaccgtcgtctttgagccttcttggtag

KEGG   Homo sapiens (human): 29108
Entry
29108             CDS       T01001                                 

Gene name
PYCARD, ASC, CARD5, TMS, TMS-1, TMS1
Definition
(RefSeq) PYD and CARD domain containing
  KO
K12799  apoptosis-associated speck-like protein containing a CARD
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05135  Yersinia infection
hsa05164  Influenza A
Network
nt06139  NLR signaling (viruses and bacteria)
nt06170  Influenza A virus (IAV)
  Element
N00742  NLRP3 Inflammasome signaling pathway
N00743  IAV NS1 to NLRP3 inflammasome signaling pathway
N00864  Yersinia YopK to NLRP3 Inflammasome signaling pathway
N00865  Yersinia YopK to NLRC4 Inflammasome signaling pathway
N00866  Yersinia YopM to Pyrin Inflammasome signaling pathway
N00867  NLRC4 Inflammasome signaling pathway
N00868  Pyrin Inflammasome signaling pathway
N00933  Escherichia NleA to NLRP3 inflammasome signaling pathway
N00934  Non-canonical inflammasome signaling pathway
N00948  Shigella IpaH7.8 to NLRP3 Inflammasome signaling pathway
N00949  Shigella IpaB to NLRC4 Inflammasome signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    29108 (PYCARD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    29108 (PYCARD)
   04623 Cytosolic DNA-sensing pathway
    29108 (PYCARD)
   04625 C-type lectin receptor signaling pathway
    29108 (PYCARD)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    29108 (PYCARD)
   05132 Salmonella infection
    29108 (PYCARD)
   05131 Shigellosis
    29108 (PYCARD)
   05135 Yersinia infection
    29108 (PYCARD)
   05133 Pertussis
    29108 (PYCARD)
   05134 Legionellosis
    29108 (PYCARD)
  09172 Infectious disease: viral
   05164 Influenza A
    29108 (PYCARD)
SSDB
Motif
Pfam: CARD PYRIN
Other DBs
NCBI-GeneID: 29108
NCBI-ProteinID: NP_037390
OMIM: 606838
HGNC: 16608
Ensembl: ENSG00000103490
Vega: OTTHUMG00000176753
Pharos: Q9ULZ3(Tbio)
UniProt: Q9ULZ3
LinkDB
Structure
PDB: 
6N1H 3J63 5H8O 2KN6 1UCP

Position
16p11.2
AA seq 195 aa
MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFY
LETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRA
ALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQA
LRESQSYLVEDLERS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggggcgcgcgcgcgacgccatcctggatgcgctggagaacctgaccgccgaggagctc
aagaagttcaagctgaagctgctgtcggtgccgctgcgcgagggctacgggcgcatcccg
cggggcgcgctgctgtccatggacgccttggacctcaccgacaagctggtcagcttctac
ctggagacctacggcgccgagctcaccgctaacgtgctgcgcgacatgggcctgcaggag
atggccgggcagctgcaggcggccacgcaccagggctctggagccgcgccagctgggatc
caggcccctcctcagtcggcagccaagccaggcctgcactttatagaccagcaccgggct
gcgcttatcgcgagggtcacaaacgttgagtggctgctggatgctctgtacgggaaggtc
ctgacggatgagcagtaccaggcagtgcgggccgagcccaccaacccaagcaagatgcgg
aagctcttcagtttcacaccagcctggaactggacctgcaaggacttgctcctccaggcc
ctaagggagtcccagtcctacctggtggaggacctggagcggagctga

KEGG   Homo sapiens (human): 834
Entry
834               CDS       T01001                                 

Gene name
CASP1, ICE, IL1BC, P45
Definition
(RefSeq) caspase 1
  KO
K01370  caspase 1 [EC:3.4.22.36]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05135  Yersinia infection
hsa05164  Influenza A
hsa05171  Coronavirus disease - COVID-19
Network
nt06139  NLR signaling (viruses and bacteria)
nt06170  Influenza A virus (IAV)
  Element
N00742  NLRP3 Inflammasome signaling pathway
N00863  Yersinia YopM to NLRP3 Inflammasome signaling pathway
N00867  NLRC4 Inflammasome signaling pathway
N00868  Pyrin Inflammasome signaling pathway
N00934  Non-canonical inflammasome signaling pathway
N00948  Shigella IpaH7.8 to NLRP3 Inflammasome signaling pathway
N00949  Shigella IpaB to NLRC4 Inflammasome signaling pathway
N01126  Salmonella SipB to Inflammasome signaling pathway
N01127  Salmonella SopE to Inflammasome signaling pathway
Drug target
Belnacasan: D10416
Emricasan: D10004
Nivocasan: D09938
Pralnacasan: D08978
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    834 (CASP1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    834 (CASP1)
   04623 Cytosolic DNA-sensing pathway
    834 (CASP1)
   04625 C-type lectin receptor signaling pathway
    834 (CASP1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    834 (CASP1)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    834 (CASP1)
   05132 Salmonella infection
    834 (CASP1)
   05131 Shigellosis
    834 (CASP1)
   05135 Yersinia infection
    834 (CASP1)
   05133 Pertussis
    834 (CASP1)
   05134 Legionellosis
    834 (CASP1)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    834 (CASP1)
   05164 Influenza A
    834 (CASP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    834 (CASP1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    834 (CASP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     834 (CASP1)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C14: caspase family
   834 (CASP1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    834 (CASP1)
SSDB
Motif
Pfam: Peptidase_C14 CARD DUF3783
Other DBs
NCBI-GeneID: 834
NCBI-ProteinID: NP_001244047
OMIM: 147678
HGNC: 1499
Ensembl: ENSG00000137752
Vega: OTTHUMG00000048072
Pharos: P29466(Tchem)
UniProt: P29466 A8K249
LinkDB
Structure
PDB: 

Position
11q22.3
AA seq 404 aa
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDS
VIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDN
PAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRT
GAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIR
EGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVG
VSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEY
ACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggccgacaaggtcctgaaggagaagagaaagctgtttatccgttccatgggtgaaggt
acaataaatggcttactggatgaattattacagacaagggtgctgaacaaggaagagatg
gagaaagtaaaacgtgaaaatgctacagttatggataagacccgagctttgattgactcc
gttattccgaaaggggcacaggcatgccaaatttgcatcacatacatttgtgaagaagac
agttacctggcagggacgctgggactctcagcagatcaaacatctggaaattaccttaat
atgcaagactctcaaggagtactttcttcctttccagctcctcaggcagtgcaggacaac
ccagctatgcccacatcctcaggctcagaagggaatgtcaagctttgctccctagaagaa
gctcaaaggatatggaaacaaaagtcggcagagatttatccaataatggacaagtcaagc
cgcacacgtcttgctctcattatctgcaatgaagaatttgacagtattcctagaagaact
ggagctgaggttgacatcacaggcatgacaatgctgctacaaaatctggggtacagcgta
gatgtgaaaaaaaatctcactgcttcggacatgactacagagctggaggcatttgcacac
cgcccagagcacaagacctctgacagcacgttcctggtgttcatgtctcatggtattcgg
gaaggcatttgtgggaagaaacactctgagcaagtcccagatatactacaactcaatgca
atctttaacatgttgaataccaagaactgcccaagtttgaaggacaaaccgaaggtgatc
atcatccaggcctgccgtggtgacagccctggtgtggtgtggtttaaagattcagtagga
gtttctggaaacctatctttaccaactacagaagagtttgaggatgatgctattaagaaa
gcccacatagagaaggattttatcgctttctgctcttccacaccagataatgtttcttgg
agacatcccacaatgggctctgtttttattggaagactcattgaacatatgcaagaatat
gcctgttcctgtgatgtggaggaaattttccgcaaggttcgattttcatttgagcagcca
gatggtagagcgcagatgcccaccactgaaagagtgactttgacaagatgtttctacctc
ttcccaggacattaa

DBGET integrated database retrieval system